Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441218560
StrainM_smegmatis_MKD8
Protein IDZP_20977767.1
Description putative pyridoxamine 5'-phosphate oxidase-related protein [Mycobact
Sequence MGTFVISGGTDGIGKAIAANRLKLGHEVVVIGRDAAKGQAFLDSAADIGA
VDRAHFVVADLSLVSQTRRAIDEIGNCISEIDGLVLCARHFRTTRAVTAE
GLEHTFALYYLSRFVLSHRLVGLLDAAEAPVILNVSGPGSGTDSIRWDDL
GGEHDYEPQRILAQGGQLNDLLGVGFARRRVSPKTRYVLVHPGVVNTGFS
GEYDAATADRIEQIRATAQPVEDAIVPILDILDHPPAEPLTAVVEGRPID
VHGPAFDAALADRLYDQTTVLLGSLASAAMGVSPARLRQVLDAPVFGTVA
TIDPDGAPQQSVVWVGRDGDDVLFAVATGSRKERNLRRDPRVSILLSPPD
EPYTYAVIHGKATLHTEGGHQLRDALAVKYTGKTYAEGNADAAARYGDVA
MTVVRVTPERTVGRL
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo