Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441218604
StrainM_smegmatis_MKD8
Protein IDZP_20977811.1
Description antibiotic biosynthesis monooxygenase domain protein [Mycobacterium
Sequence MAVTVLLELKFKPDSVVDAREVFGKALEATRSFAGNLVTKVIVDETDEAH
WIIYERWESVEHDEAYRAFRAGEGKIDDLPPLLAAPPVKTRYLDTEI
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo