Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
| gene ID | 57117165 |
| Strain | Mtb_H37Rv |
| Protein ID | YP_178023.1 |
| Description | esxA gene product [Mycobacterium tuberculosis H37Rv] |
| Sequence | MTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEA YQGVQQKWDATATELNNALQNLARTISEAGQAMASTEGNVTGMFA |
| B cell epitope (IEDB) | 0 |
| T cell epitope (IEDB) | 348 |
| MHC binder (IEDB) | 417 |
| Vaccine Target | Yes |
| B cell prediction (LBtope) | 63 |
| MHC class II prediction (Propred) | 14 |
| MHC class 1 prediction (Propred1) | 120 |
| CTL epitope prediction (CTLpred) | 14 |
| Prediction of interferon-gamma inducing peptides (IFNepitope) | 100 |
| Prediction of IL4 inducing peptides (IL4pred) | 145 |