• Home
• Browse
• Search
• Advanced search
• Blast
• Map
• Negpep
• Modpep
• Update
• Help
• Download
• Authors
• Contact

Browse By

• Peptide Source


• Cell line


• Target


• Assay


• Author
Total number of Results for Immunoprecipitation are 2
Results from 0 - 25


HIPid	Sequence	Length	Source	Cell line	Target	Assay	Reference
HIP1064	ASTTTNYT	8	Synthetic	NA	Fusion inhibitor	Immunoprecipitation	3026840
HIP1093	WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL	34	gp41	MT-2	Fusion inhibitor	Immunoprecipitation	12805467

 CSIR-Institute of Microbial Technology, Chandigarh 160036, India