HIPdb

Browse By

Peptide Source

Cell line

Target

Assay

Author

Total number of Results for

de Soultrait VR

Results from

0 - 25

HIPid	Sequence	Length	Source	Cell line	Target	Assay	Reference
HIP231	YQLLIRMIYKNI	12	Synthetic	HeLa	Integrase	Disintegration assay	12054767
HIP148	YQLLIRMIY	9	Synthetic	HeLa	Integrase	Disintegration assay	12054767
HIP229	YQLLIRMIYKAI	12	Synthetic	HeLa	Integrase	Disintegration assay	12054767
HIP218	YALLIRMIYKNI	12	Synthetic	HeLa	Integrase	Disintegration assay	12054767
HIP777	QLLIRMIYKNILFYLVPGPGHGAEPERRNIKYL	33	Synthetic	HeLa	Integrase	Disintegration assay	12054767
HIP230	YQLLIRMIYKNA	12	Synthetic	HeLa	Integrase	Disintegration assay	12054767
HIP228	YQLLIRMIYANI	12	Synthetic	HeLa	Integrase	Disintegration assay	12054767
HIP222	YQLAIRMIYKNI	12	Synthetic	HeLa	Integrase	Disintegration assay	12054767
HIP178	QLLIRMIYKNI	11	Synthetic	HeLa	Integrase	Disintegration assay	12054767
HIP224	YQLLIAMIYKNI	12	Synthetic	HeLa	Integrase	Disintegration assay	12054767
HIP226	YQLLIRMAYKNI	12	Synthetic	HeLa	Integrase	Disintegration assay	12054767
HIP227	YQLLIRMIAKNI	12	Synthetic	HeLa	Integrase	Disintegration assay	12054767
HIP223	YQLLARMIYKNI	12	Synthetic	HeLa	Integrase	Disintegration assay	12054767
HIP173	AEPERRNIKYL	11	Synthetic	HeLa	Integrase	Disintegration assay	12054767
HIP225	YQLLIRAIYKNI	12	Synthetic	HeLa	Integrase	Disintegration assay	12054767
HIP770	RMIYKNILFYLVPGPGHGAEPERRNIKYL	29	Synthetic	HeLa	Integrase	Disintegration assay	12054767
HIP138	YQLLIRMI	8	Synthetic	HeLa	Integrase	Disintegration assay	12054767
HIP221	YQALIRMIYKNI	12	Synthetic	HeLa	Integrase	Disintegration assay	12054767
HIP776	LSELDDRADALQAGASQFETSAAKLKRKYWWKN	33	Synthetic	HeLa	Integrase	Disintegration assay	12054767
HIP154	LFYLVPGPGH	10	Synthetic	HeLa	Integrase	Disintegration assay	12054767
HIP98	QLLIRMI	7	Synthetic	HeLa	Integrase	Disintegration assay	12054767
HIP232	YQLLIRPIYKNI	12	Synthetic	HeLa	Integrase	Disintegration assay	12054767

HIPdb

Database of HIV inhibiting peptides

Browse By