| ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 1321 | RRIRPRPPRLPRPRPRPLPFPRPG | Bac1-24 | 24 | L | Linear | Protein derived | Antimicrobial | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 12450378 |
| 1322 | RRIRPRPPRLPRPRPRP | Bac1-17 | 17 | L | Linear | Protein derived | Antimicrobial | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 12450378 |
| 1323 | PRPPRLPRPRPRPLPFPRPG | Bac5-24 | 20 | L | Linear | Protein derived | Antimicrobial | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 12450378 |
| 1324 | PPRLPRPRPRPLPFPRPG | Bac7-24 | 18 | L | Linear | Protein derived | Antimicrobial | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 12450378 |
| 1325 | RLPRPRPRPLPFPRPG | Bac9-24 | 16 | L | Linear | Protein derived | Antimicrobial | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 12450378 |
| 1326 | PRPRPRPLPFPRPG | Bac11-24 | 14 | L | Linear | Protein derived | Antimicrobial | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 12450378 |
| 1327 | PRPRPLPFPRPG | Bac13-24 | 12 | L | Linear | Protein derived | Antimicrobial | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 12450378 |
| 1328 | PRPLPFPRPG | Bac15-24 | 10 | L | Linear | Protein derived | Antimicrobial | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 12450378 |
| 1329 | RKKRRQRRR | Tat (49-57) | 9 | L | Linear | Protein derived | Cationic | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 12450378 |
| 1425 | AKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKK | F3 | 34 | L | Linear | Protein derived | Unknown | Conjugation with fluorescein with 6-aminohexanoic acid (Ahx) spacer | Free | NA | Fluorophore (fluorescein) | 12032302 |
| 1426 | akvkdepqrrsarlsakpappkpepkpkkapakk | D form of F3 | 34 | D | Linear | Protein derived | Unknown | Conjugation with fluorescein with 6-aminohexanoic acid (Ahx) spacer | Free | NA | Protein (eGFP) | 12032302 |
| 1427 | PLSSIFSRIGDP | PreS2 (41-52) | 12 | L | Linear | Protein derived | Amphipathic | Conjugation with EGFP | Free | NA | Protein (eGFP) | 10822301 |
| 1428 | PSSSSSSRIGDP | PreS2 3S Mutant | 12 | L | Linear | Protein derived | Non-amphipathic | Conjugation with EGFP | Free | NA | Fluorophore (fluorescein) | 10822301 |
| 1429 | vrlpppvrlpppvrlppp | D form of Sweat Arrow Protein (SAP) | 18 | D | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 17635150 |
| 1430 | VELPPPVELPPPVELPPP | Sweet Arrow Protein (SAP) (E) | 18 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein/ rhodamine B | Free | NA | Fluorophore (fluoresceine/ rhodamine) | 21365733 |
| 1480 | RGGRLSYSRRRFSTSTGR | SynB1 | 18 | L | Linear | Protein derived | Antimicrobial | Conjugation with NBD and TAMRA | Free | NA | Fluorophore (NBD and TAMRA) | 12783857 |
| 1481 | rggrlsysrrrfststgr | D-SynB1 | 18 | D | Linear | Protein derived | Antimicrobial | Conjugation with NBD | Free | NA | Fluorophore (NBD) | 12783857 |
| 1482 | RRLSYSRRRF | SynB3 | 10 | L | Linear | Protein derived | Antimicrobial | Conjugation with NBD and TAMRA | Free | NA | Fluorophore (NBD and TAMRA) | 12783857 |
| 1483 | rrlsysrrrf | D-SynB3 | 10 | D | Linear | Protein derived | Antimicrobial | Conjugation with NBD | Free | NA | Fluorophore (NBD) | 12783857 |
| 1484 | RGGRLAYLRRRWAVLGR | SynB5 | 17 | L | Linear | Protein derived | Antimicrobial | Conjugation with NBD and TAMRA | Free | NA | Fluorophore (NBD and TAMRA) | 12783857 |
| 1485 | RQIKIWFQNRRMKWKK | Penetratin {pAntp-(43-58)} | 16 | L | Linear | Protein derived | Amphipathic | Conjugation with NBD and TAMRA | Free | NA | Fluorophore (NBD and TAMRA) | 12783857 |
| 1494 | YGRKKRRQRRR | Tat (47-57) | 11 | L | Linear | Protein derived | Cationic | Conjugation with Texas red | Free | NA | Fluorophore (Texas Red) | 12417587 |
| 1495 | RHIKIWFQNRRMKWKK | PDX -1-PTD | 16 | L | Linear | Protein derived | Amphipathic | Conjugation with FITC | Free | NA | Fluorophore (FITC) | 12829640 |
| 1503 | MLLLTRRRST | BagP | 10 | L | Linear | Protein derived | Cationic | Biotinylation or Conjugation with TMR | Free | NA | Fluorophor (TMR) | 16808988 |
| 1509 | VRLPPP | PolyP 1 | 6 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 15054781 |
| 1510 | VRLPPPVRLPPP | PolyP 2 | 12 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 15054781 |
| 1511 | VRLPPPVRLPPPVRLPPP | PolyP 3 (SAP) | 18 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 15054781 |
| 1512 | VHLPPP | PolyP 4 | 6 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 15054781 |
| 1513 | VHLPPPVHLPPP | PolyP 5 | 12 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 15054781 |
| 1514 | VHLPPPVHLPPPVHLPPP | PolyP 6 | 18 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 15054781 |
| 1515 | VKLPPP | PolyP 7 | 6 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 15054781 |
| 1516 | VKLPPPVKLPPP | PolyP 8 | 12 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 15054781 |
| 1517 | VKLPPPVKLPPPVKLPPP | PolyP 9 | 18 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 15054781 |
| 1527 | YKQCHKKGGKKGSG | (1-9)-(38-42) Crot | 14 | L | Linear | Protein derived | Unknown | Conjugation with rhodamine B | Free | NA | Fluorophore (rhodamine) | 18983137 |
| 1528 | YKQCHKKGGXKKGSG | (1-9)-Ahx-(38-42) Crot | 15 | L | Linear | Protein derived | Unknown | Conjugation with rhodamine B | Free | NA | Fluorophore (rhodamine) | 18983137 |
| 1529 | GSGKKGGKKHCQKY | (42-38)-(9-1) Crot | 14 | L | Linear | Protein derived | Unknown | Conjugation with rhodamine B | Free | NA | Fluorophore (rhodamine) | 18983137 |
| 1530 | GSGKKGGKKICQKY | D form of (1-9)-(38-42) Crot | 14 | L | Linear | Protein derived | Unknown | Conjugation with rhodamine B | Free | NA | Fluorophore (rhodamine) | 18983137 |
| 1535 | RLSGMNEVLSFRWL | SG3 | 14 | L | Linear | Synthetic | Unknown | Conjugation with EGFP | Free | NA | Protein (GFP) | 21291271 |
| 1536 | GPFHFYQFLFPPV | 435B peptide | 13 | L | Linear | Synthetic | Unknown | Conjugation with FITC | Free | NA | Fluorophore (FITC) | 17268054 |
| 1537 | GSPWGLQHHPPRT | 439A peptide | 13 | L | Linear | Synthetic | Unknown | Conjugation with FITC | Free | NA | Fluorophore (FITC) | 17268054 |
| 1539 | AAVALLPAVLLALLAPEILLPNNYNAYESYKYPGMFIALSK | SKP | 41 | L | Linear | Chimeric | Unknown | Tyrosine radiolabeling with Iodine 125 | Free | NA | NA | 7782278 |
| 1556 | GRRHHCRSKAKRSRHH | hPER1- PTD (830-846) NLS | 16 | L | Linear | Protein derived | Unknown | Biotinylation | Free | NA | Biotin | 15781181 |
| 1557 | SARHHCRSKAKRSRHH | hPER1-PTD alanine subsitution mutant | 16 | L | Linear | Protein derived | Unknown | Biotinylation | Free | NA | Biotin | 15781181 |
| 1558 | SRAHHCRSKAKRSRHH | hPER1-PTD alanine subsitution mutant | 16 | L | Linear | Protein derived | Unknown | Biotinylation | Free | NA | Biotin | 15781181 |
| 1559 | SRRAHCRSKAKRSRHH | hPER1-PTD alanine subsitution mutant | 16 | L | Linear | Protein derived | Unknown | Biotinylation | Free | NA | Biotin | 15781181 |
| 1560 | SRRHACRSKAKRSRHH | hPER1-PTD alanine subsitution mutant | 16 | L | Linear | Protein derived | Unknown | Biotinylation | Free | NA | Biotin | 15781181 |
| 1561 | SRRHHARSKAKRSRHH | hPER1-PTD alanine subsitution mutant | 16 | L | Linear | Protein derived | Unknown | Biotinylation | Free | NA | Biotin | 15781181 |
| 1562 | SRRHHCRAKAKRSRHH | hPER1-PTD alanine subsitution mutant | 16 | L | Linear | Protein derived | Unknown | Biotinylation | Free | NA | Biotin | 15781181 |
| 1563 | SRRHHCRSAAKRSRHH | hPER1-PTD alanine subsitution mutant | 16 | L | Linear | Protein derived | Unknown | Biotinylation | Free | NA | Biotin | 15781181 |
| 1564 | SRRHHCRSKAARSRHH | hPER1-PTD alanine subsitution mutant | 16 | L | Linear | Protein derived | Unknown | Biotinylation | Free | NA | Biotin | 15781181 |