Browse result page of CPPsite 2.0
The total number entries retrieved from this search are 741| ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 2854 | KKLALHALHLLALLWLHLAHLALKK | LAH4-X1 | 25 | L | Linear | Synthetic | Amphipathic | Free | Free | NA | Nucleic acid (Plasmid DNA) | 22226847 |
| 2855 | FKKLALHALHLLALLWLHLAHLALKK | LAH4-X1F1 | 26 | L | Linear | Synthetic | Amphipathic | Free | Free | NA | Nucleic acid (Plasmid DNA) | 22226847 |
| 2856 | FFKKLALHALHLLALLWLHLAHLALKK | LAH4-X1F2 | 27 | L | Linear | Synthetic | Amphipathic | Free | Free | NA | Nucleic acid (Plasmid DNA) | 22226847 |
| 2857 | KHKALHALHLLALLWLHLAHLAKHK | LAH6-X1 | 25 | L | Linear | Synthetic | Amphipathic | Free | Free | NA | Nucleic acid (Plasmid DNA) | 22226847 |
| 2858 | KHKLLHLLHLLALLWLHLLHLLKHK | LAH6-X1L-W | 25 | L | Linear | Synthetic | Amphipathic | Free | Free | NA | Nucleic acid (Plasmid DNA) | 22226847 |
| 2859 | RLWMRWYSPRTRAYG | RLW | 15 | L | Linear | Synthetic | NA | Free | Free | NA | Nanoparticle (PEG-PCL) | 25448586 |
| 2860 | RRRRRRRR | R8 | 8 | L | Linear | Synthetic | Cationic | Free | Free | NA | Nanoparticle (PEG-PCL) | 25448586 |
| 2861 | NTCTWLKYHS | Peptide 1 | 10 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (FITC) | 25562654 |
| 2862 | CASGQQGLLKLC | Peptide 2 | 12 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (FITC) | 25562654 |
| 2863 | YNNFAYSVFL | Peptide 3 | 10 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (FITC) | 25562654 |
| 2864 | ECYPKKGQDP | Peptide 4 | 10 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (FITC) | 25562654 |
| 2865 | RHVYHVLLSQ | Peptide 5 | 10 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (FITC) | 25562654 |
| 2866 | HATKSQNINF | Peptide 6 | 10 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (FITC) | 25562654 |
| 2867 | YRDRFAFQPH | Peptide 7 | 10 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (FITC) | 25562654 |
| 2868 | IWRYSLASQQ | Peptide 8 | 10 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (FITC) | 25562654 |
| 2869 | YQKQAKIMCS | Peptide 9 | 10 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (FITC) | 25562654 |
| 2870 | VQLRRRWC | Peptide 10 | 8 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (FITC) | 25562654 |
| 2871 | RRRRRRRRR | R9 | 9 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (FITC) | 25562654 |
| 2872 | NTGTWLKYHS | Peptide 1-C3G | 10 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (FITC) | 25562654 |
| 2873 | TCTWLKYHS | Peptide 1-NΔ | 9 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (FITC) | 25562654 |
| 2874 | NTCTWLKYH | Peptide 1-SΔ | 9 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (FITC) | 25562654 |
| 2875 | TCTWLKYH | Peptide 1-NSΔ | 8 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (FITC) | 25562654 |
| 2876 | CTWLKYH | Peptide 1-NTSΔ | 7 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (FITC) | 25562654 |
| 2877 | TWLKYH | Peptide 1-NTCSΔ | 6 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (FITC) | 25562654 |
| 2878 | CTWLKY | Peptide 1-NTHSΔ | 6 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (FITC) | 25562654 |
| 2889 | KKKKKKNKKLQQRGD | P1 | 15 | L | Linear | Protein derived | Cationic | Conjugation with FITC | Free | Linker 6-aminohexamoic acid (Ahx) | Fluorophore (FITC) | 25459448 |
| 2890 | RGDGPRRRPRKRRGR | P2 | 15 | L | Linear | Protein derived | Cationic | Conjugation with FITC | Free | Linker 6-aminohexamoic acid (Ahx) | Fluorophore (FITC) | 25459448 |
| 2891 | RRRQKRIVVRRRLIR | P3 | 15 | L | Linear | Protein derived | Cationic | Conjugation with FITC | Free | Linker 6-aminohexamoic acid (Ahx) | Fluorophore (FITC) | 25459448 |
| 2892 | RRVWRRYRRQRWCRR | P4 | 15 | L | Linear | Protein derived | Cationic | Conjugation with FITC | Free | Linker 6-aminohexamoic acid (Ahx) | Fluorophore (FITC) | 25459448 |
| 2893 | RRARRPRRLRPAPGR | P5 | 15 | L | Linear | Protein derived | Cationic | Conjugation with FITC | Free | Linker 6-aminohexamoic acid (Ahx) | Fluorophore (FITC) | 25459448 |
| 2894 | LLRARWRRRRSRRFR | P6 | 15 | L | Linear | Protein derived | Cationic | Conjugation with FITC | Free | Linker 6-aminohexamoic acid (Ahx) | Fluorophore (FITC) | 25459448 |
| 2895 | RGPRRQPRRHRRPRR | P7 | 15 | L | Linear | Protein derived | Cationic | Conjugation with FITC | Free | Linker 6-aminohexamoic acid (Ahx) | Fluorophore (FITC) | 25459448 |
| 2896 | RRWRRWNRFNRRRCR | P8 | 15 | L | Linear | Protein derived | Cationic | Conjugation with FITC | Free | Linker 6-aminohexamoic acid (Ahx) | Fluorophore (FITC) | 25459448 |
| 2897 | GRKKRRQRRRPPQ | Tat | 13 | L | Linear | Protein derived | Cationic | Conjugation with FITC | Free | Linker 6-aminohexamoic acid (Ahx) | Fluorophore (FITC) | 25459448 |
| 2899 | RQIKIWFQNRRMKWKK | L-Penetratin | 16 | L | Linear | Protein derived | Cationic and amphipathic | Free | Free | NA | Protein (Insulin) | 25445695 |
| 2900 | rqikiwfqnrrmkwkk | D-Penetratin | 16 | D | Linear | Protein derived | Cationic and amphipathic | Free | Free | NA | Protein (Insulin) | 25445695 |
| 2901 | MAARLCCQLDPARDVLCLRP | N-terminus of X-Pep | 20 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC) | 25251474 |
| 2902 | MAARLCCQLDPARDV | N-terminus of X-Pep | 15 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC) | 25251474 |
| 2903 | MAARLCCQ | X-Pep | 8 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC) | 25251474 |
| 2904 | MAARL | X-Pep derivative | 5 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC) | 25251474 |
| 2905 | YGRKKRRQRRR | TAT (47-57) | 11 | L | Linear | Protein derived | Cationic | Free | Free | NA | Nanoparticle (Quantum dots) | 25570933 |
| 2906 | YGRKKRRQRRRGLFGAIAGFIENGWEGMIDGWYG | TAT-HA2 | 34 | L | Linear | Synthetic | NA | Free | Free | NA | Nanoparticle (Quantum dots) | 25570933 |
| 2907 | RRLSYSRRRF | SynB3 | 10 | L | Linear | Protein derived | Cationic | Free | Free | NA | Protein (Endomorphin-1) | 25245547 |
| 2908 | RHHRRHHRRHRRHHRRHHRHHR | B6 | 22 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
| 2909 | HHHRRRRRRRRRHHH | D8 | 15 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
| 2910 | HHHHHHRRRRRRRRR | D9 | 15 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
| 2911 | RRRRRRRRR | F7 | 9 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
| 2912 | RHHLRHLRRHLRHLLRHLRHHLRHLRRHLRHLL | A1 | 33 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
| 2913 | RLHHRLHRRLHRLHRRLHRLHHRLHRRLH | A2 | 29 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
| 2914 | LRHLLRHLLRHLRHLLRHLRHLLRHLLRH | A3 | 29 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |