Browse result page of CPPsite 2.0
The total number entries retrieved from this search are 1564| ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 1195 | KMDCRWRPKCCKK | Crot (27-39) derevative | 13 | L | Linear | Protein derived | Cystein rich | Conjugation with K-FITC | Free | NA | Fluorophore (FITC) | 21319732 |
| 1196 | KMDCRPRPKCCKK | Crot (27-39) derevative | 13 | L | Linear | Protein derived | Cystein rich | Conjugation with K-FITC | Free | NA | Fluorophore (FITC) | 21319732 |
| 1202 | RQIKIWFQNRRMKWKK | Penetratin (pAntp) | 16 | L | Linear | Protein derived | Amphipathic | Conjugation with K-FITC | Free | NA | Fluorophore (FITC) | 21319732 |
| 1206 | RKKRRRESRKKRRRES | DPV3 | 16 | L | Linear | Protein derived | Unknown | Cys addition | Free | NA | Protein (PO and IgG) | 15859953 |
| 1207 | GRPRESGKKRKRKRLKP | DPV6 | 17 | L | Linear | Protein derived | Unknown | Cys addition | Free | NA | Protein (PO and IgG) | 15859953 |
| 1208 | GKRKKKGKLGKKRDP | DPV7 | 15 | L | Linear | Protein derived | Unknown | Cys addition | Free | NA | Protein (PO and IgG) | 15859953 |
| 1209 | GKRKKKGKLGKKRPRSR | DPV7b | 17 | L | Linear | Protein derived | Unknown | Cys addition | Free | NA | Protein (PO and IgG) | 15859953 |
| 1210 | RKKRRRESRRARRSPRHL | DPV3/10 | 18 | L | Linear | Protein derived | Unknown | Cys addition | Free | NA | Protein (PO and IgG) | 15859953 |
| 1211 | SRRARRSPRESGKKRKRKR | DPV10/6 | 19 | L | Linear | Protein derived | Unknown | Cys addition | Free | NA | Protein (PO and IgG) | 15859953 |
| 1212 | VKRGLKLRHVRPRVTRMDV | DPV1047 | 19 | L | Linear | Protein derived | Unknown | Cys addition | Free | NA | Protein (PO and IgG) | 15859953 |
| 1213 | SRRARRSPRHLGSG | DPV10 | 14 | L | Linear | Protein derived | Unknown | Cys addition | Free | NA | Protein (PO and IgG) | 15859953 |
| 1214 | LRRERQSRLRRERQSR | DPV15 | 16 | L | Linear | Protein derived | Unknown | Cys addition | Free | NA | Protein (PO and IgG) | 15859953 |
| 1215 | GAYDLRRRERQSRLRRRERQSR | DPV15b | 22 | L | Linear | Protein derived | Unknown | Cys addition | Free | NA | Protein (PO and IgG) | 15859953 |
| 1216 | GRKKRRQRRRPPQ | Tat (48-60) | 13 | L | Linear | Protein derived | Cationic | Cys addition | Free | NA | Protein (PO and IgG) | 15859953 |
| 1217 | VPMLK | Bip1 | 5 | L | Linear | Protein derived | Unknown | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 21359136 |
| 1218 | VPTLK | Bip2 | 5 | L | Linear | Protein derived | Unknown | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 21359136 |
| 1219 | VPALR | Bip3 | 5 | L | Linear | Protein derived | Unknown | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 21359136 |
| 1220 | VSALK | Bip4 | 5 | L | Linear | Protein derived | Unknown | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 21359136 |
| 1221 | PMLKE | Bip5 | 5 | L | Linear | Protein derived | Unknown | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 21359136 |
| 1222 | VPALK | Bip6 | 5 | L | Linear | Protein derived | Unknown | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 21359136 |
| 1223 | VSLKK | Bip7 | 5 | L | Linear | Protein derived | Unknown | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 21359136 |
| 1224 | VSGKK | Bip8 | 5 | L | Linear | Protein derived | Unknown | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 21359136 |
| 1225 | KLPVM | Bip9 | 5 | L | Linear | Protein derived | Unknown | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 21359136 |
| 1226 | IPMIK | Bip10 | 5 | L | Linear | Protein derived | Unknown | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 21359136 |
| 1227 | KLGVM | Bip11 | 5 | L | Linear | Protein derived | Unknown | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 21359136 |
| 1228 | KLPVT | Bip12 | 5 | L | Linear | Protein derived | Unknown | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 21359136 |
| 1229 | VPMIK | Bip13 | 5 | L | Linear | Protein derived | Unknown | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 21359136 |
| 1230 | IPALK | Bip14 | 5 | L | Linear | Protein derived | Unknown | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 21359136 |
| 1231 | IPMLK | Bip15 | 5 | L | Linear | Protein derived | Unknown | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 21359136 |
| 1232 | VPTLQ | Bip16 | 5 | L | Linear | Protein derived | Unknown | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 21359136 |
| 1233 | QLPVM | Bip17 | 5 | L | Linear | Protein derived | Unknown | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 21359136 |
| 1234 | ELPVM | Bip18 | 5 | L | Linear | Protein derived | Unknown | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 21359136 |
| 1235 | VPTLE | Bip19 | 5 | L | Linear | Protein derived | Unknown | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 21359136 |
| 1237 | RRRRRRRR | R8 | 8 | L | Linear | Synthetic | Cationic | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 21359136 |
| 1238 | AYRIKPTFRRLKWKYKGKFW | L1 (Ala32 substitution mutant of LALF (32-51)) | 20 | L | Linear | Protein derived | Cationic amphipathic | Biotinylation | Free | NA | Biotin | 19908203 |
| 1239 | HARIKPTFRRLKWKYKGKFW | L2 (Ala33 substitution mutant of LALF (32-51)) | 20 | L | Linear | Protein derived | Cationic amphipathic | Biotinylation | Free | NA | Biotin | 19908203 |
| 1240 | HYRIKPTARRLKWKYKGKFW | L8 (Ala39 substitution mutant of LALF (32-51)) | 20 | L | Linear | Protein derived | Cationic amphipathic | Biotinylation | Free | NA | Biotin | 19908203 |
| 1241 | HYRIKPTFRRLAWKYKGKFW | L12 (Ala43 substitution mutant of LALF (32-51)) | 20 | L | Linear | Protein derived | Cationic amphipathic | Biotinylation | Free | NA | Biotin | 19908203 |
| 1242 | HYRIKPTFRRLKWKYKGKFA | L20 (Ala51 substitution mutant of LALF (32-51)) | 20 | L | Linear | Protein derived | Cationic amphipathic | Biotinylation | Free | NA | Biotin | 19908203 |
| 1243 | VNADIKATTVFGGKYVSLTTP | Inv1 | 21 | L | Linear | Protein derived | Unknown | Free (peptide coated FITC labelled microspheres) | Free | NA | Nanoparticle [(FITC)-labeled latex microspheres] | 16620748 |
| 1244 | GKYVSLTTPKNPTKRRITPKDV | Inv2 | 22 | L | Linear | Protein derived | Unknown | Free (peptide coated FITC labelled microspheres) | Free | NA | Nanoparticle [(FITC)-labeled latex microspheres] | 16620748 |
| 1245 | TKRRITPKDVIDVRSVTTEINT | Inv3 | 22 | L | Linear | Protein derived | Unknown | Free (peptide coated FITC labelled microspheres) | Free | NA | Nanoparticle [(FITC)-labeled latex microspheres] | 16620748 |
| 1246 | RSVTTEINTLFQTLTSIAEKVDP | Inv4 | 23 | L | Linear | Protein derived | Unknown | Free (peptide coated FITC labelled microspheres) | Free | NA | Nanoparticle [(FITC)-labeled latex microspheres] | 16620748 |
| 1247 | AEKVDPVKLNLTLSAAAEALTGLGDK | Inv5 | 26 | L | Linear | Protein derived | Unknown | Free (peptide coated FITC labelled microspheres) | Free | NA | Nanoparticle [(FITC)-labeled latex microspheres] | 16620748 |
| 1248 | GLGDKFGESIVNANTVLDDLNSRMPQSRHDIQQL | Inv6 | 34 | L | Linear | Protein derived | Unknown | Free (peptide coated FITC labelled microspheres) | Free | NA | Nanoparticle [(FITC)-labeled latex microspheres] | 16620748 |
| 1249 | GDVYADAAPDLFDFLDSSVTTARTINA | Inv7 | 27 | L | Linear | Protein derived | Unknown | Free (peptide coated FITC labelled microspheres) | Free | NA | Nanoparticle [(FITC)-labeled latex microspheres] | 16620748 |
| 1250 | ARTINAQQAELDSALLAAAGFGNTTADVFDRG | Inv8 | 32 | L | Linear | Protein derived | Unknown | Free (peptide coated FITC labelled microspheres) | Free | NA | Nanoparticle [(FITC)-labeled latex microspheres] | 16620748 |
| 1251 | ADVFDRGGPYLQRGVADLVPTATLLDTYSP | Inv9 | 30 | L | Linear | Protein derived | Unknown | Free (peptide coated FITC labelled microspheres) | Free | NA | Nanoparticle [(FITC)-labeled latex microspheres] | 16620748 |
| 1252 | LDTYSPELFCTIRNFYDADRPDRGAAA | Inv10 | 27 | L | Linear | Protein derived | Unknown | Free (peptide coated FITC labelled microspheres) | Free | NA | Nanoparticle [(FITC)-labeled latex microspheres] | 16620748 |
| 1253 | TKRRITPKDVIDVRSVTTEINT | Inv11 | 22 | L | Linear | Protein derived | Unknown | Free (peptide coated FITC labelled microspheres) | Free | NA | Nanoparticle [(FITC)-labeled latex microspheres] | 16620748 |