ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
---|---|---|---|---|---|---|---|---|---|---|---|---|
2881 | A-NII-Aib-PLL-Aib-PIC | P-II | 12 | Modified | Linear | Synthetic | NA | Acetylation | Amidation | Aib, α-amino isobutyric acid | Fluorophore (Fluorescien) and Nucleic acid (oligonucleotides) | 25468041 |
2882 | Aib-NII-A-PLL-Aib-PIC | P-III | 12 | Modified | Linear | Synthetic | NA | Acetylation | Amidation | Aib, α-amino isobutyric acid | Fluorophore (Fluorescien) and Nucleic acid (oligonucleotides) | 25468041 |
2883 | Aib-NII-Aib-Aib-LL-Aib-Aib-IC | P-IV | 12 | Modified | Linear | Synthetic | NA | Acetylation | Amidation | Aib, α-amino isobutyric acid | Fluorophore (Fluorescien) and Nucleic acid (oligonucleotides) | 25468041 |
2884 | Aib-NII-Aib-PLL-Aib-Aib-IC | P-V | 12 | Modified | Linear | Synthetic | NA | Acetylation | Amidation | Aib, α-amino isobutyric acid | Fluorophore (Fluorescien) and Nucleic acid (oligonucleotides) | 25468041 |
2885 | Aib-NII-Aib-Aib-LL-Aib-PIC | P-VI | 12 | Modified | Linear | Synthetic | NA | Acetylation | Amidation | Aib, α-amino isobutyric acid | Fluorophore (Fluorescien) and Nucleic acid (oligonucleotides) | 25468041 |
2886 | VKRFKKFFRKLKKSV | B1 | 15 | L | Linear | Synthetic | NA | Free | Amidation | NA | Fluorophore (FITC) | 25462264 |
2887 | VKRFKKFFRKLKKLV | B1-Leu | 15 | L | Linear | Synthetic | NA | Free | Amidation | NA | Fluorophore (FITC) | 25462264 |
2888 | VKRFKKFFRKLKKKV | B1-Lys | 15 | L | Linear | Synthetic | NA | Free | Amidation | NA | Fluorophore (FITC) | 25462264 |
2889 | KKKKKKNKKLQQRGD | P1 | 15 | L | Linear | Protein derived | Cationic | Conjugation with FITC | Free | Linker 6-aminohexamoic acid (Ahx) | Fluorophore (FITC) | 25459448 |
2890 | RGDGPRRRPRKRRGR | P2 | 15 | L | Linear | Protein derived | Cationic | Conjugation with FITC | Free | Linker 6-aminohexamoic acid (Ahx) | Fluorophore (FITC) | 25459448 |
2891 | RRRQKRIVVRRRLIR | P3 | 15 | L | Linear | Protein derived | Cationic | Conjugation with FITC | Free | Linker 6-aminohexamoic acid (Ahx) | Fluorophore (FITC) | 25459448 |
2892 | RRVWRRYRRQRWCRR | P4 | 15 | L | Linear | Protein derived | Cationic | Conjugation with FITC | Free | Linker 6-aminohexamoic acid (Ahx) | Fluorophore (FITC) | 25459448 |
2893 | RRARRPRRLRPAPGR | P5 | 15 | L | Linear | Protein derived | Cationic | Conjugation with FITC | Free | Linker 6-aminohexamoic acid (Ahx) | Fluorophore (FITC) | 25459448 |
2894 | LLRARWRRRRSRRFR | P6 | 15 | L | Linear | Protein derived | Cationic | Conjugation with FITC | Free | Linker 6-aminohexamoic acid (Ahx) | Fluorophore (FITC) | 25459448 |
2895 | RGPRRQPRRHRRPRR | P7 | 15 | L | Linear | Protein derived | Cationic | Conjugation with FITC | Free | Linker 6-aminohexamoic acid (Ahx) | Fluorophore (FITC) | 25459448 |
2896 | RRWRRWNRFNRRRCR | P8 | 15 | L | Linear | Protein derived | Cationic | Conjugation with FITC | Free | Linker 6-aminohexamoic acid (Ahx) | Fluorophore (FITC) | 25459448 |
2897 | GRKKRRQRRRPPQ | Tat | 13 | L | Linear | Protein derived | Cationic | Conjugation with FITC | Free | Linker 6-aminohexamoic acid (Ahx) | Fluorophore (FITC) | 25459448 |
2898 | HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK | PACAP | 38 | L | Linear | Protein derived | Cationic | Free | Amidation | NA | Fluorophore (Fluorescien) | 25447531 |
2899 | RQIKIWFQNRRMKWKK | L-Penetratin | 16 | L | Linear | Protein derived | Cationic and amphipathic | Free | Free | NA | Protein (Insulin) | 25445695 |
2900 | rqikiwfqnrrmkwkk | D-Penetratin | 16 | D | Linear | Protein derived | Cationic and amphipathic | Free | Free | NA | Protein (Insulin) | 25445695 |
2901 | MAARLCCQLDPARDVLCLRP | N-terminus of X-Pep | 20 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC) | 25251474 |
2902 | MAARLCCQLDPARDV | N-terminus of X-Pep | 15 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC) | 25251474 |
2903 | MAARLCCQ | X-Pep | 8 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC) | 25251474 |
2904 | MAARL | X-Pep derivative | 5 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC) | 25251474 |
2905 | YGRKKRRQRRR | TAT (47-57) | 11 | L | Linear | Protein derived | Cationic | Free | Free | NA | Nanoparticle (Quantum dots) | 25570933 |
2906 | YGRKKRRQRRRGLFGAIAGFIENGWEGMIDGWYG | TAT-HA2 | 34 | L | Linear | Synthetic | NA | Free | Free | NA | Nanoparticle (Quantum dots) | 25570933 |
2907 | RRLSYSRRRF | SynB3 | 10 | L | Linear | Protein derived | Cationic | Free | Free | NA | Protein (Endomorphin-1) | 25245547 |
2908 | RHHRRHHRRHRRHHRRHHRHHR | B6 | 22 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2909 | HHHRRRRRRRRRHHH | D8 | 15 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2910 | HHHHHHRRRRRRRRR | D9 | 15 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2911 | RRRRRRRRR | F7 | 9 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2912 | RHHLRHLRRHLRHLLRHLRHHLRHLRRHLRHLL | A1 | 33 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2913 | RLHHRLHRRLHRLHRRLHRLHHRLHRRLH | A2 | 29 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2914 | LRHLLRHLLRHLRHLLRHLRHLLRHLLRH | A3 | 29 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2915 | LRHHLRHLLRHLRHLLRHLRHHLRHLLRH | A4 | 29 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2916 | RLHRRLHRRLHRLHRRLHRLHRRLHRRLH | A5 | 29 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2917 | RHHLRHLRRHLRHLLRHLRHHL | B5 | 22 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2918 | LHHLLHHLLHLLHHLLHHLHHL | B8 | 22 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2919 | RRHLRRHLRHLRRHLRRHLRHL | B9 | 22 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2920 | RLHLRLHLRHLRHHLRLH | C4 | 18 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2921 | RLHHRLHRRLHRLHR | D11 | 15 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2922 | LRHLLRHLLRHLRHL | D12 | 15 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2923 | RLHRRLHRRLHRLHR | E2 | 15 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2924 | RHHLRHLRRHL | F3 | 11 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2925 | AEAEAEAEAKAKAKAKAGGGHRRRRRRR | A9 | 28 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2926 | RFTFHFRFEFTFHFEGGGRRRRRRR | A10 | 25 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2927 | FQFNFQFNGGGHRRRRRRR | C1 | 19 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2928 | AEAEAEAEAKAKAKAK | C11 | 16 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2929 | RFTFHFRFEFTFHFE | E3 | 15 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2930 | RHNFRFFFNFRTNR | E7 | 14 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |