Example Output/Result of Prediction Module

Thanks for submitting your peptides to Prediction Module of PEP2D server. Our server PEP2D, predicted secondary structure of your peptides, result/output is given below in table. User can download the prediction results in text format. First row contains name of peptide and link for downloading secondary structure in PDF format. Second and third row shows secondary structure in graphical and text format respectively.

Download your results in text format CLICK HERE

Secondary structure of peptide (TestSeq), PDF format.
Sequence   : TISCTNEKQCYPHCKKETGYPNAKCMNRKCKCFGR
Structure  : CCCCCCHHHHHHHHHHHCCCCCEEEECCEEEECCC
Helix Prob : 00000088888889999000000000000000000
Sheet Prob : 00000000000000000000008888008888000
Coil  Prob : 98799900000000000899990000990000789