HIPdb

Browse By

Peptide Source

Cell line

Target

Assay

Author

Total number of Results for

Integrase

26

Results from

0 - 25

« previous12 next »

HIPid	Sequence	Length	Source	Cell line	Target	Assay	Reference
HIP1135	AGERIVDIIATDIQ	14	Integrase	NA	Integrase	Integrase Assay	12643937
HIP1134	HLKTAVQMAVFIHNFKR	17	Integrase	NA	Integrase	Integrase Assay	12643937
HIP1133	QETAYFLLKLAGRWP	15	Integrase	NA	Integrase	Integrase Assay	12643937
HIP1137	AGERIVDIIA	10	Integrase	NA	Integrase	Integrase Assay	12643937
HIP1136	QETAYFLLKLAGR	13	Integrase	NA	Integrase	Integrase Assay	12643937
HIP1043	STTVKAASWWA	11	Integrase	NA	Integrase	Integrase Assay	12643937
HIP1042	GYIEAEVI	8	Integrase	NA	Integrase	Integrase Assay	12643937
HIP1045	SQGVVESMNKELKKIIGQVRDQAEHLKTAY	30	Integrase	NA	Integrase	Integrase Assay	8856082
HIP617	KGEAMHGQVDCSPGIWQLDC	20	Integrase	NA	Reverse Transcriptase	Dot-blot binding assay	17257575
HIP709	THLEGKVILVAVHVASGYIE	20	Integrase	NA	Reverse Transcriptase	Dot-blot binding assay	17257575
HIP276	ASCDKCQLKGEAMHG	15	Integrase	NA	Reverse Transcriptase	Dot-blot binding assay	17257575
HIP314	KCQLKGEAMHGQVDC	15	Integrase	NA	Reverse Transcriptase	Dot-blot binding assay	17257575
HIP332	MHGQVDCSPGIWQLD	15	Integrase	NA	Reverse Transcriptase	Dot-blot binding assay	17257575
HIP337	PGIWQLDCTHLEGKI	15	Integrase	NA	Reverse Transcriptase	Dot-blot binding assay	17257575
HIP602	GRWPVKTIHTDNGSNFTGAT	20	Integrase	NA	Reverse Transcriptase	Dot-blot binding assay	17257575
HIP616	KELKKIIGQVRDQAEHLKTA	20	Integrase	NA	Reverse Transcriptase	Dot-blot binding assay	17257575
HIP705	TDIQTKELQKQITKIQNFRV	20	Integrase	NA	Reverse Transcriptase	Dot-blot binding assay	17257575
HIP364	VDCSPGIWQLDCTHL	15	Integrase	NA	Reverse Transcriptase	Dot-blot binding assay	17257575
HIP1046	VESMNEELKKIIAQVRAQAEHLKTAY	27	Integrase	NA	Integrase	NMR	10567389
HIP1138	ATGQETAYFLLKLAGKA	17	Integrase	NA	Integrase	Integrase Assay	11705373
HIP1113	DQAEHLKTAVQMAVFIHNYKA	21	Integrase	NA	Integrase	Integrase Assay	22742518
HIP1102	RQIKIWFQNRRMKWKK	16	Integrase	TZM-bl	Integrase	RT-PCR	19961612
HIP971	VESMNKELPKIIGQVRDQAEHLKTAY	26	integrase	NA	Integrase	Integrase assay	9578482
HIP969	SQGVVESMNKELKKIIGQVRDQAEHLKTAY	30	Integrase	NA	Integrase	Integrase assay	9578482
HIP970	SQGVVESMNKELPKIIGQVRDQAEHLKTAY	30	Integrase	NA	Integrase	Integrase assay	9578482

« previous12 next »

CSIR-Institute of Microbial Technology, Chandigarh 160036, India