Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID161 | RPPGFSPF | Bradykinin | Serum | 904.4726 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS | 19728888 |
| CancerPDF_ID162 | NDNEEGFFSAR | Fibrinopeptide B | Serum | 1129.4849 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS | 19728888 |
| CancerPDF_ID163 | NA | NA | Serum | 1183.5995 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID164 | NA | NA | Serum | 1201.5663 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID165 | GEGDFLAEGGGVR | Fibrinopeptide A | Serum | 1263.5958 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS | 19728888 |
| CancerPDF_ID166 | NA | NA | Serum | 1288.6006 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID167 | NA | NA | Serum | 1347.5297 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID168 | SGEGDFLAEGGGVR | Fibrinopeptide A | Serum | 1350.6275 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID169 | NA | NA | Serum | 1389.6433 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID170 | NA | NA | Serum | 1402.671 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID171 | NA | NA | Serum | 1418.539 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID172 | NA | NA | Serum | 1432.644 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID173 | NA | NA | Serum | 1440.5407 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID174 | NA | NA | Serum | 1445.5828 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID175 | NA | NA | Serum | 1447.6855 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID176 | NA | NA | Serum | 1450.4893 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID177 | NA | NA | Serum | 1456.5093 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID178 | NA | NA | Serum | 1458.4946 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID179 | NA | NA | Serum | 1460.6257 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID180 | NA | NA | Serum | 1477.6539 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID181 | NA | NA | Serum | 1479.6646 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID182 | NA | NA | Serum | 1487.6226 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID183 | NA | NA | Serum | 1491.6634 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID184 | NA | NA | Serum | 1501.748 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID185 | NA | NA | Serum | 1503.5994 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID186 | NA | NA | Serum | 1507.6643 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID187 | ADSGEGDFLAEGGGVR | fibrinopeptide A; | Serum | 1536.6906 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS | 19728888 |
| CancerPDF_ID188 | EGVNDNEEGFFSA | Glu-1-fibrinopeptide B; | Serum | 1552.669 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS | 19728888 |
| CancerPDF_ID189 | NA | NA | Serum | 1561.7288 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID190 | NA | NA | Serum | 1569.6823 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID191 | NA | NA | Serum | 1573.7005 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID192 | ADSGEGDFLAEGGGVR | phospho-fibrinopeptide A | Serum | 1616.6366 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS and Peptide signature for differentiation between healthy and NSCLC patients | 19728888 |
| CancerPDF_ID193 | NA | NA | Serum | 1630.6679 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID194 | NA | NA | Serum | 1670.5947 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID195 | KITHRIHWESASLL | Complement C3f | Serum | 1690.9254 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS | 19728888 |
| CancerPDF_ID196 | SKITHRIHWESASLL | Complement C3f | Serum | 1777.966 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS | 19728888 |
| CancerPDF_ID197 | SSKITHRIHWESASLL | Complement C3f | Serum | 1865.0022 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS | 19728888 |
| CancerPDF_ID198 | NA | NA | Serum | 2494.1536 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID199 | HKSEVAHRFKDLGEENFKALVL | Serum albumin | Serum | 2567.3659 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS | 19728888 |
| CancerPDF_ID200 | AVPPNNSNAAEDDLPTVELQGVVPR | Coagulation factor XIIIA | Serum | 2602.3048 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS | 19728888 |
| CancerPDF_ID201 | NA | NA | Serum | 2743.4663 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID202 | NA | NA | Serum | 2747.4349 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID203 | NA | NA | Serum | 2789.0914 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID204 | NVHSGSTFFKYYLQGAKIPKPEASFSPR | inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 3156.6207 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS | 19728888 |
| CancerPDF_ID205 | SKITHRIHWESASLL | Complement C3 f | Serum | 1777.966 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID206 | NA | NA | Serum | 1877.9926 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID207 | NA | NA | Serum | 1545.616 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID208 | KITHRIHWESASLL | Complement C3 f | Serum | 1690.9254 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID209 | SSKITHRIHWESASLL | Complement C3 f | Serum | 1865.0022 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID210 | NA | NA | Serum | 1039.6249 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID211 | NA | NA | Serum | 1361.7417 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID212 | NA | NA | Serum | 880.4127 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID213 | NA | NA | Serum | 1041.6349 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID214 | NA | NA | Serum | 1955.9949 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID215 | NA | NA | Serum | 1015.6267 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID216 | NA | NA | Serum | 1087.5722 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID217 | NA | NA | Serum | 1063.6231 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID218 | NA | NA | Serum | 1092.5826 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID219 | NA | NA | Serum | 2318.2202 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID220 | NA | NA | Serum | 2536.2991 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID221 | NA | NA | Serum | 2105.4972 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID222 | NA | NA | Serum | 1396.5679 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID223 | NA | NA | Serum | 2112.022 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID224 | NA | NA | Serum | 987.5905 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID225 | ADSGEGDFLAEGGGVR | Phospho-fibrinopetide A | Serum | 1616.6366 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID226 | SPMYSIITPNILRLESEETM | Complement C3 beta/f | Serum | 2324.1475 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Signature peptide that can Differentiate between NSCLC patients and healthy volunteers | 19728888 |
| CancerPDF_ID227 | NA | NA | Serum | 2104.998 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID228 | NA | NA | Serum | 2153.0655 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID229 | NA | NA | Serum | 1450.4893 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID230 | SPMYSIITPNILRLESEET | Complement C3 beta/f | Serum | 2193.1036 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Signature peptide that can Differentiate between NSCLC patients and healthy volunteers | 19728888 |
| CancerPDF_ID231 | NA | NA | Serum | 898.4169 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID232 | NA | NA | Serum | 3427.8221 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID233 | NA | NA | Serum | 2163.9817 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID234 | NA | NA | Serum | 1670.5947 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID235 | NA | NA | Serum | 2099.1139 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID236 | NA | NA | Serum | 1456.5093 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID237 | NA | NA | Serum | 1418.539 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID238 | NA | NA | Serum | 1630.6679 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID239 | NA | NA | Serum | 2228.0362 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID240 | NA | NA | Serum | 2209.0934 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID241 | VLSPADKTNVKAAWGKVGAHAGEYGAEALERM | Hemoglobin alpha | Serum | 3326.6863 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Signature peptide that can Differentiate between NSCLC patients and healthy volunteers | 19728888 |
| CancerPDF_ID242 | NA | NA | Serum | 1434.5136 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID243 | VLSPADKTNVKAAWGKVGAHAGEYGAEALERMF | Hemoglobin alpha | Serum | 3473.7545 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Signature peptide that can Differentiate between NSCLC patients and healthy volunteers | 19728888 |
| CancerPDF_ID244 | NA | NA | Serum | 1432.644 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID245 | NA | NA | Serum | 1292.4157 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID246 | NA | NA | Serum | 1440.5407 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID247 | NA | NA | Serum | 2246.1744 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID248 | NA | NA | Serum | 2789.0914 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID249 | NVHSGSTFFKYYLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 3156.6207 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID250 | NA | NA | Serum | 1276.456 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID251 | NA | NA | Serum | 1458.4946 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID252 | NA | NA | Serum | 2489.3052 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID253 | NA | NA | Serum | 2318.2202 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID254 | NA | NA | Serum | 2209.0934 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID255 | NA | NA | Serum | 2215.2849 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID256 | NA | NA | Serum | 2376.2096 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID257 | NA | NA | Serum | 1545.616 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID258 | NA | NA | Serum | 2215.2849 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients with a partial response versus patients with stable or progressive disease | 19728888 |
| CancerPDF_ID259 | NA | NA | Serum | 2009.0039 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients with a partial response versus patients with stable or progressive disease | 19728888 |
| CancerPDF_ID260 | NA | NA | Serum | 2318.2202 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients with a partial response versus patients with stable or progressive disease | 19728888 |
| CancerPDF_ID261 | NA | NA | Serum | 2378.1982 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients with a partial response versus patients with stable or progressive disease | 19728888 |
| CancerPDF_ID262 | NA | NA | Serum | 900.4258 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients with a partial response versus patients with stable or progressive disease | 19728888 |
| CancerPDF_ID263 | NA | Fibrinopeptide A | Serum | 1616.6366 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients with a partial response versus patients with stable or progressive disease | 19728888 |
| CancerPDF_ID264 | NA | NA | Serum | 1596.189 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients with a partial response versus patients with stable or progressive disease | 19728888 |
| CancerPDF_ID265 | NA | NA | Serum | 872.4325 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients with a partial response versus patients with stable or progressive disease | 19728888 |
| CancerPDF_ID266 | NA | NA | Serum | 3215.1939 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients with a partial response versus patients with stable or progressive disease | 19728888 |
| CancerPDF_ID267 | NA | NA | Serum | 1631.2111 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients with a partial response versus patients with stable or progressive disease | 19728888 |