Browse result page of CancerPDF Database

Please click on CancerPDF_ID for detailed information about peptide.

CancerPDF_IDPeptide seqProtein NameFluidMass/ZProfiling TechniqueCancer Type Expression RegulationPUBMED ID
CancerPDF_ID958 NANASerum5907.39MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID961 NANASerum4210.93MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID962 NANASerum9300.76MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID963 NANASerum2660.82MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID964 NANASerum7772.38MALDI-TOFColorectal cancer Upregulated and considered as candidate biomarker 23091368
CancerPDF_ID966 NANASerum1617.78MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID968 NANASerum4645.43MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID969 NANASerum4091.82MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID972 NANASerum1466.77MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID974 NANASerum1546.58MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID975 NANASerum3241.4MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID976 NANASerum5338.71MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID978 NANASerum2952.94MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID979 NANASerum3952.53MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID980 NANASerum4965.34MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID981 NANASerum4054.81MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID982 NANASerum2863.08MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID983 NANASerum3263.36MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID984 NANASerum3883.56MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID985 NANASerum1866.35MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID986 NANASerum1520.21MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID987 NANASerum1450.62MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID988 NANASerum4268.26MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID989 NANASerum4123.72MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID990 NANASerum5868.38MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID991 NANASerum3192.38MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID992 NANASerum2884.13MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID993 NANASerum4073.6MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID994 NANASerum2932.84MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID995 NANASerum2105.88MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID996 NANASerum4169.7MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID997 NANASerum2900.31MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID999 NANASerum2769.91MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID1000 NANASerum1540.23MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID1001 NANASerum3935.5MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID1002 NANASerum1779.25MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID1003 NANASerum2644.78MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID1005 NANASerum5755.96MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID1006 NANASerum4155.14MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID1007 NANASerum5636.48MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID1008 NANASerum2723.35MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID1009 NANASerum1207.42MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID1011 NANASerum1351MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID1013 NANASerum2545.55MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID1014 NANASerum2877.97MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID1015 NANASerum4110.58MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID1016 NANASerum5066.24MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID1017 NANASerum4676.49MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID1018 NANASerum2046.31MALDI-TOFColorectal cancer Upregulated in cancer vs normal 23091368
CancerPDF_ID1028 GSESGIFTNTKESSSHHPGIAEFPSRGFibrinogen alpha chainSerum2816.25MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 68, 223 and 1 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1029 SSSYSKQFTSSTSYNRGDSTFESFibrinogen alpha chainSerum2553.01MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 1.35, 1.31 and 1.5 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1031 SSSYSKQFTSSTSYNRGDSTFESKSYFibrinogen alpha chainSerum2931.29MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Downregulated in bladder cancer and upregulated in prostate cancer vs normal with Ratio of median intensity (patients/Controls) = 1.24, 0.13 and 0.97 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1037 DEAGSEADHEGTHSTKRGHAKSRPVFibrinogen alpha chainSerum2659.03MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 1.37, 1.18 and 2.45 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1040 IHWESASLLComplement C3fSerum1055.6MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 227, 1051 and 1 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1041 RIHWESASLLComplement C3fSerum1211.7MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =7.86, 10.8 and 0.01 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1049 SSKITHRIHWESASLComplement C3fSerum1751.88MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.82, 5.7 and 1.36 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1050 NGFKSHALQLNNRComplement C4 precursorSerum1498.91MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1, 809 and 1 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1051 NGFKSHALQLNNRQComplement C4 precursorSerum1626.85MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.09, 0.88 and 2.78 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1052 NGFKSHALQLNNRQIComplement C4 precursorSerum1739.93MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =0.75, 0.66 and 2.75 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1053 NGFKSHALQLNNRQIRComplement C4 precursorSerum1895.99MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.27, 3.33 and 2.95 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1055 GLEEELQFSLGSKINVKVGGNSComplement C4 precursorSerum2305.2MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =3.75, 2.56 and 3.49 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1056 GLEEELQFSLGSKINVKVGGNSKGTLComplement C4 precursorSerum2704.13MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =61, 49 and 133 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1059 HAAYHPFInter-alpha-trypsin inhibitor heavy chain H4Serum842.4MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in Prostate cancer vs normal,Downregulated in Bladder cancer vs normal with Ratio of median intensity (patients/Controls) =1.49, 0.01 and 1.04 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1060 GLPGPPDVPDHAAYHPFInter-alpha-trypsin inhibitor heavy chain H5Serum1786.86MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =2.39, 2.88 and 2.3 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1062 SRQLGLPGPPDVPDHAAYHPFInter-alpha-trypsin inhibitor heavy chain H7Serum2271.14MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =4.58, 2.64 and 1.46 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1063 SSRQLGLPGPPDVPDHAAYHPFInter-alpha-trypsin inhibitor heavy chain H8Serum2358.09MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =100, 73 and 531 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1065 PGVLSSRQLGLPGPPDVPDHAAYHPFInter-alpha-trypsin inhibitor heavy chain H10Serum2724.48MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.75, 6.17 and 1.64 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1066 MNFRPGVLSSRQLGLPGPPDVPDHAAYHPFInter-alpha-trypsin inhibitor heavy chain H11Serum3272.5MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1, 1277 and 1 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1067 QAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPFInter-alpha-trypsin inhibitor heavy chain H12Serum3970.97MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1, 957 and 1 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1068 QLGLPGPPDVPDHAAYHPFRInter-alpha-trypsin inhibitor heavy chain H13Serum2183.91MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.71, 1.79 and 2.83 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1069 HAAYHPFRInter-alpha-trypsin inhibitor heavy chain H14Serum998.45MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =121, 256 and 147 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1070 NVHSGSTFFKYYLQGAKIPKPEASFSPRInter-alpha-trypsin inhibitor heavy chain H15Serum3156.52MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =3.43, 10.68 and 1.33 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1071 NVHSAGAAGSRMNFRPGVLSSPRO1851(ITIH4 splice variant)Serum2115.01MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =3.22, 12.23 and 10.61 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1072 ATEHLSTLSEKAKPALEDLApolipoprotein A-ISerum2052.89MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =105, 306 and 1 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1073 QGLLPVLESFKVSFLSALEEYTKKLNTQApolipoprotein A-ISerum3182.46MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =0.74, 6.36 and 1 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1074 VSFLSALEEYTKKLNTQApolipoprotein A-ISerum1971.16MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1, 641 and 1 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1077 ISASAEELRQRLAPLAEDVRGNLApolipoprotein A-IVSerum2508.16MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.38, 1.2 and 7.96 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1078 SLAELGGHLDQQVEEFApolipoprotein A-IVSerum1771.81MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =148, 220 and 1 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1080 GNTEGLQKSLAELGGHLDQQVEEFRApolipoprotein A-IVSerum2755.2MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.11, 12.37 and 1.22 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1081 SLAELGGHLDQQVEEFRApolipoprotein A-IVSerum1927.94MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =79, 671 and 1 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1084 AATVGSLAGQPLQERAQAWGERLApolipoprotein ESerum2409.13MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =97, 2124 and 109 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1085 AATVGSLAGQPLQERAQAWGERLRApolipoprotein ESerum2565.45MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1, 902 and 1 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1086 HFFFPKClusterin precursorSerum822.41MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.15, 4.66 and 0.76 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1087 HFFFPKSRIVClusterin precursorSerum1277.71MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =251, 1406 and 1 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1092 NLGHGHKHERDQGHGHQHMW KininogenSerum1943.88MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.58, 141 and 1 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1093 KHNLGHGHKHERDQGHGHQHMW KininogenSerum2209.08MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.72, 2.07 and 1.56 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1095 AVPPNNSNAAEDDLPTVELQGVVPRFactor XIIIaSerum2602.15MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =2.84, 2.3 and 4.73 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1096 ALGISPFHEHAEVVFTANDSGPRTranstherin precursor (‘prealbumin’)Serum2451.11MALDI-TOF"Advanced Prostate, Breast and Bladder cancer" "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =0.02, 1.17 and 3.07 in prostate, bladder and breast cancer respectively" 16395409
CancerPDF_ID1172 NANASerum3279.25MALDI-TOFLung cancer Upregulated in cancer vs normal with average expression of peptide in cancer 4.22 and in normal 1.87 21082738
CancerPDF_ID1173 NANASerum2881.24MALDI-TOFLung cancer Upregulated in cancer vs normal with average expression of peptide in cancer 3.01 and in normal 1.47 21082738
CancerPDF_ID1175 NANASerum3208.59MALDI-TOFLung cancer Upregulated in cancer vs normal with average expression of peptide in cancer 2.57 and in normal 1.56 21082738
CancerPDF_ID1176 NANASerum1741.48MALDI-TOFLung cancer Upregulated in cancer vs normal with average expression of peptide in cancer 4.13 and in normal 2.11 21082738
CancerPDF_ID1177 NANASerum6047.99MALDI-TOFLung cancer Upregulated in cancer vs normal with average expression of peptide in cancer 1.3 and in normal 0.86 21082738
CancerPDF_ID1179 NANASerum5248.05MALDI-TOFLung cancer Upregulated in cancer vs normal with average expression of peptide in cancer 1.38 and in normal 1.02 21082738
CancerPDF_ID1180 NANASerum5079.93MALDI-TOFLung cancer Upregulated in cancer vs normal with average expression of peptide in cancer 1.4 and in normal 0.89 21082738
CancerPDF_ID1186 NANASerum5293.03MALDI-TOFLung cancer Upregulated in cancer vs normal with average expression of peptide in cancer 1.52 and in normal 0.91 21082738
CancerPDF_ID1187 NANASerum4530.17MALDI-TOFLung cancer Upregulated in cancer vs normal with average expression of peptide in cancer 1.23 and in normal 0.69 21082738
CancerPDF_ID1188 NANASerum1887.19MALDI-TOFLung cancer Upregulated in cancer vs normal with average expression of peptide in cancer 2.6 and in normal 2.15 21082738
CancerPDF_ID1189 NANASerum1082.52MALDI-TOFLung cancer Upregulated in cancer vs normal with average expression of peptide in cancer 4.48 and in normal 1.68 21082738
CancerPDF_ID1190 NANASerum2770.03MALDI-TOFLung cancer Upregulated in cancer vs normal with average expression of peptide in cancer 6.6 and in normal 4.07 21082738
CancerPDF_ID1194 NANASerum1331.23MALDI-TOFLung cancer Upregulated in cancer vs normal with average expression of peptide in cancer 2.86 and in normal 2.14 21082738
CancerPDF_ID1195 NANASerum1350.83MALDI-TOFLung cancer Upregulated in cancer vs normal with average expression of peptide in cancer 2.73 and in normal 1.75 21082738
CancerPDF_ID1196 NANASerum1066.34MALDI-TOFLung cancer Upregulated in cancer vs normal with average expression of peptide in cancer 4.62 and in normal 2.44 21082738
CancerPDF_ID1198 NANASerum2545.94MALDI-TOFLung cancer Upregulated in cancer vs normal with average expression of peptide in cancer 1.96 and in normal 1.37 21082738
CancerPDF_ID1200 NANASerum2046.59MALDI-TOFLung cancer Upregulated in cancer vs normal with average expression of peptide in cancer 3.67 and in normal 2.79 21082738
CancerPDF_ID1201 NANASerum1866.51MALDI-TOFLung cancer Upregulated in cancer vs normal with average expression of peptide in cancer 6.58 and in normal 3.02 21082738
CancerPDF_ID1203 NANASerum1450.73MALDI-TOFLung cancer Upregulated in cancer vs normal with average expression of peptide in cancer 5.64 and in normal 2.81 21082738
CancerPDF_ID1204 NANASerum3061.3MALDI-TOFLung cancer Upregulated in cancer vs normal with average expression of peptide in cancer 3.12 and in normal 1.18 21082738
CancerPDF_ID1205 NANASerum4712.02MALDI-TOFLung cancer Upregulated in cancer vs normal with average expression of peptide in cancer 1.03 and in normal 0.68 21082738
CancerPDF_ID3339 NANASerum2883.76MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3342 NANASerum6047.64MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3345 NANASerum2932.99MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3346 NANASerum1887.15MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3347 NANASerum1897.93MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3349 NANASerum1741.38MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3351 NANASerum7468.37MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3352 NANASerum5292.77MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3353 NANASerum5079.68MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3354 NANASerum1350.83MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3355 NANASerum2554.64MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3356 NANASerum4529.7MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3360 NANASerum2669.09MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3361 NANASerum2878.89MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3362 NANASerum3208.49MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3365 NANASerum5264.02MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3369 NANASerum2953.31MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3370 NANASerum1450.55MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3371 NANASerum1779.31MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3375 NANASerum8562.86MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3376 NANASerum1082.44MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3377 NANASerum2769.86MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3378 NANASerum5753.12MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3379 NANASerum4281.54MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3383 NANASerum1563.43MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3384 NANASerum1331.12MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3385 NANASerum2545.83MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3386 NANASerum1866.42MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3389 NANASerum2281.08MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3390 NANASerum1563.11MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3391 NANASerum2281.08MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3392 NANASerum2682.65MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3393 NANASerum2900.91MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3394 NANASerum3279.09MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3396 NANASerum5247.81MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3397 NANASerum5336.3MALDI-TOFNon-small cell lung cancer (NSCLC) Upregulated in cancer vs normal 22628229
CancerPDF_ID3412 DGESGRpGRpGERGLpGPpGCollagen alpha-1(III) chainUrineNACE-MS-TOFBladder cancer Upregulated in cancer vs normal 21591268
CancerPDF_ID3414 AGPPGEAGKK PGEQGVPGDLCollagen type a1UrineNALC-MSCRLM( Colorectal liver metastses) Upregulated in cancer vs normal 27186406
CancerPDF_ID8612 DEAGSEADHEGTHSTKRGHAKSRPVIsoform 2 of fibrinogen (FGA) chain precursorSerum2660.11MALDI-TOFBreast cancer Upregulated in cancer as compare to normal control with fold change of 1.5 26705257
CancerPDF_ID8613 SEMVVAGKLQInter- trypsin inhibitor heavy chain H4 (ITIH4) precursorSerum1061.09MALDI-TOFBreast cancer Upregulated in cancer as compare to normal control with fold change of 1.6 26705257
CancerPDF_ID8614 MNFRPGVLSSRQLGLPGPPDVPDHAAYHPFInter- trypsin inhibitor heavy chain H4 (ITIH4) fragmentSerum3273.69MALDI-TOFBreast cancer Upregulated in cancer as compare to normal control with fold change of 1.7 26705257
CancerPDF_ID8615 IAQDLEMYGINYFEIKEZR (Ezrin fragment)Serum1945.33MALDI-TOFBreast cancer Upregulated in cancer as compare to normal control with fold change of 1.8 26705257
CancerPDF_ID8616 HNLGHGHKHERDQGHGHQIsoform HMW of kininogen-1 (KNG1) precursorSerum2082.04MALDI-TOFBreast cancer Upregulated in cancer as compare to normal control with fold change of 1.9 26705257
CancerPDF_ID8617 NVHSAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPFInter- trypsin inhibitor heavy chain H4 (ITIH4) fragmentSerum4280.55MALDI-TOFBreast cancer Upregulated in cancer as compare to normal control with fold change of 1.10 26705257
CancerPDF_ID8633 GPPGPPGPPGLGGAlpha-1 type I collagenUrine1126.503MALDI-TOFCervical cancer Upregulated in cancer vs normal 24416269
CancerPDF_ID8645 NANAPlasma2271.13MALDI-TOFCervical cancer Upregulated in cancer as compare to normal control 24416269
CancerPDF_ID8646 ALVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNPKQAAlpha 1 antichymotrypsin peptide ( C terminal fragment of protein AACT)Cerbrospinal fluidNAMALDI-TOFGlioblastoma (Malignant brain tumor) Upregulated in cancer as compare to normal control 19674866
CancerPDF_ID8647 SGPRRYTIAALLSPYSYSTTAVVTNPKETransthretin ( Cterminal fragment of protein TTHY)Cerbrospinal fluidNAMALDI-TOFGlioblastoma (Malignant brain tumor) Upregulated in cancer as compare to normal control 19674866
CancerPDF_ID8648 ANDESNEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHELDSASSEVNOsteopontin ( C terminal fragment of protein OPN)Cerbrospinal fluidNAMALDI-TOFGlioblastoma (Malignant brain tumor) Upregulated in cancer as compare to normal control 19674866
CancerPDF_ID10277 VRYTKKVPQVSTPTLSerum albumin precursorUrine1717.0035MALDI-TOFMuscle-invasive bladder cancer Upregulated with 2.26 fold change in muscle invasive bladder cancer vs non invasive bladder cancer and non cancer samples 21805675
CancerPDF_ID10339 LVRYTKKVPQVSTPTLSerum albumin precursorUrine1830.0049MALDI-TOFMuscle-invasive bladder cancer Upregulated in cancer vs normal 21805675
CancerPDF_ID10497 YSMRKMSMKIRPFFPQQFibrinogen beta chainUrine2175.0927MALDI-TOFMuscle-invasive bladder cancer Upregulated in cancer vs normal 21805675
CancerPDF_ID10557 GTLSGIGTLDGFRHRHPDEAAFFibrinogen alpha chainUrine2354.154MALDI-TOFMuscle-invasive bladder cancer Upregulated in cancer vs normal 21805675
CancerPDF_ID10575 DAHKSEVAHRFKDLGEENFKASerum albumin precursorUrine2428.2029MALDI-TOFMuscle-invasive bladder cancer Upregulated in cancer vs normal 21805675
CancerPDF_ID10584 AAHLPAEFTPAVHASLDKFLASVSHemoglobin subunit alphaUrine2479.2756MALDI-TOFMuscle-invasive bladder cancer Upregulated in cancer vs normal 21805675
CancerPDF_ID10639 DAHKSEVAHRFKDLGEENFKALVLSerum albumin precursorUrine2753.4445MALDI-TOFMuscle-invasive bladder cancer Upregulated in cancer vs normal 21805675
CancerPDF_ID11033 KEDIDTSSKGGCVQRNA-binding protein 6Serum1466.98MALDI-TOFClear cell renal carcinoma "Upregulated in ccRCC, preoperative and post operative patients vs control" 25368985
CancerPDF_ID11034 AILVDLEPGTMDSVRtubulin beta chainSerum1618.22MALDI-TOFClear cell renal carcinoma "Upregulated in ccRCC, preoperative and post operative patients vs control" 25368985
CancerPDF_ID11035 IHTGENPYECSECGKAFRYSSALVRHQRIHTGEKPLNGIGMSKSSLRVTTELNzinc finger protein 3 Serum5905.23MALDI-TOFClear cell renal carcinoma "Upregulated in ccRCC, preoperative and post operative patients vs control" 25368985
CancerPDF_ID11041 NANASerum5752.25MALDI-TOFClear cell renal carcinoma "Upregulated in ccRCC, preoperative and post operative patients vs control" 25368985
CancerPDF_ID11042 NANASerum5724.76MALDI-TOFClear cell renal carcinoma "Upregulated in ccRCC, preoperative and post operative patients vs control" 25368985
CancerPDF_ID11043 NANASerum5844.36MALDI-TOFClear cell renal carcinoma "Upregulated in ccRCC, preoperative and post operative patients vs control" 25368985
CancerPDF_ID11044 NANASerum5739.69MALDI-TOFClear cell renal carcinoma "Upregulated in ccRCC, preoperative and post operative patients vs control" 25368985
CancerPDF_ID11045 NANASerum5818.83MALDI-TOFClear cell renal carcinoma "Upregulated in ccRCC, preoperative and post operative patients vs control" 25368985
CancerPDF_ID11046 NANASerum4091.86MALDI-TOFClear cell renal carcinoma "Upregulated in ccRCC, preoperative and post operative patients vs control" 25368985
CancerPDF_ID11047 NANASerum1714.57MALDI-TOFClear cell renal carcinoma "Upregulated in ccRCC, preoperative and post operative patients vs control" 25368985
CancerPDF_ID11051 NRIPESGGDNSVFDIFELTGAARKGSGRThrombospondin-1Serum2950.6MALDI-TOFEsophageal squamous cell carcinoma (ESCC) Upregulated in patients vs normal with mean intensity 84.95 in control and 666.08 in cancer 26993605
CancerPDF_ID11052 SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAKSRPVFibrinogen alpha chainSerum5900MALDI-TOFEsophageal squamous cell carcinoma (ESCC) Upregulated in patients vs normal with mean intensity 100.55 in normal and 831.12 in cancer 26993605
CancerPDF_ID11054 SSYSKQFTSSTSYNRGDSTFibrinogen alpha chainSerum2102.7MALDI-TOFEsophageal squamous cell carcinoma (ESCC) Upregulated in ESCC patients vs control with mean intensity in cancer as 532.28 and mean intensity in control as 266.24 26993605
CancerPDF_ID11056 SYKMADEAGSEADHEGTHSTKRGHAKSRPVFibrinogen alpha chainSerum3239.9MALDI-TOFEsophageal squamous cell carcinoma (ESCC) Upregulated in ESCC patients vs control with mean intensity in cancer as 831.12 and mean intensity in control as 100.55 26993605
CancerPDF_ID11058 NVHSGSTFFKYYLQGAKIPKPEASITIH4Serum2669.1MALDI-TOFEsophageal squamous cell carcinoma (ESCC) Upregulated in ESCC patients vs control with mean intensity in cancer 417.72 and mean intensity in normal 190.00 26993605
CancerPDF_ID11059 QLGLPGPPDVPDHAAYHPFITIH4Serum2026.8MALDI-TOFEsophageal squamous cell carcinoma (ESCC) "Upregulated in ESCC patients vs control with mean intensity in cancer as 2,730.99 and mean intensity in normal 1,290.54" 26993605
CancerPDF_ID11060 CSRDNTLKVIDLRisoform CRA_bSerum1532.1MALDI-TOFEsophageal squamous cell carcinoma (ESCC) "Upregulated in ESCC patients vs control with mean intensity in cancer as 1,022.00 and mean intensity in normal as 527.84" 26993605
CancerPDF_ID11061 NANASerum5924.6MALDI-TOFEsophageal squamous cell carcinoma (ESCC) Upregulated in ESCC patients vs control with mean intensity in cancer as 425.63 and mean intensity in normal as 50.61 26993605
CancerPDF_ID11062 NANASerum5910MALDI-TOFEsophageal squamous cell carcinoma (ESCC) Upregulated in ESCC patients vs control with mean intensity in cancer as 739.57 and mean intensity in normal as 87.40 26993605
CancerPDF_ID11063 NANASerum5882.1MALDI-TOFEsophageal squamous cell carcinoma (ESCC) Upregulated in ESCC patients vs control with mean intensity in cancer as 681.97 and mean intensity in normal as 114.65 26993605
CancerPDF_ID11064 NANASerum4209.6MALDI-TOFEsophageal squamous cell carcinoma (ESCC) Upregulated in ESCC patients vs control with mean intensity in cancer as 1772.59 and mean intensity in normal as 696.17 26993605
CancerPDF_ID11065 NANASerum4199.6MALDI-TOFEsophageal squamous cell carcinoma (ESCC) Upregulated in ESCC patients vs control with mean intensity in cancer as 1767.14 and mean intensity in normal as 867.09 26993605
CancerPDF_ID11066 NANASerum4225.6MALDI-TOFEsophageal squamous cell carcinoma (ESCC) Upregulated in ESCC patients vs control with mean intensity in cancer as 526.85 and mean intensity in normal as224.98 26993605
CancerPDF_ID11067 NANASerum3883.6MALDI-TOFEsophageal squamous cell carcinoma (ESCC) Upregulated in ESCC patients vs control 26993605
CancerPDF_ID11068 NANASerum3249.2MALDI-TOFEsophageal squamous cell carcinoma (ESCC) Upregulated in ESCC patients vs control 26993605
CancerPDF_ID11069 NANASerum4086.1MALDI-TOFEsophageal squamous cell carcinoma (ESCC) Upregulated in ESCC patients vs control 26993605
CancerPDF_ID11073 SSSYSKQFTSST SYNRGDSTFESKSYKMADEAGSEADHEGTH STKRGHAKSRFibrinogen alpha chainBlood5910MALDI-TOFGastric cancer Upregulated in gastric patients vs healthy with 45.5±13.1 intesity in cancer patients and 9.2±4.7 intensity in normal pateints 26662807
CancerPDF_ID11076 NAA1AG1_HUMANUrine1755.759MALDI-TOFClear cell renal carcinoma "Upregulated with increse in tumor mass,primary tumor stage" 26482227
CancerPDF_ID11077 NAA1AG2_HUMANUrine1755.759MALDI-TOFClear cell renal carcinoma "Upregulated with increse in tumor mass,primary tumor stage" 26482227
CancerPDF_ID11086 NAFIBA_HUMANUrine2660.82MALDI-TOFClear cell renal carcinoma Upregulated with increse in tumor mass 26482227
CancerPDF_ID11098 NAGP162_HUMANUrine2192.1MALDI-TOFClear cell renal carcinoma Upregulated in pT1b compared to pT1a patients 26482227
CancerPDF_ID11099 NAKPB1_HUMANUrine2192.1MALDI-TOFClear cell renal carcinoma Upregulated in pT1b compared to pT1a patients 26482227
CancerPDF_ID11100 NAHBA_HUMANUrine2790.7MALDI-TOFClear cell renal carcinoma Upregulated in pT1b compared to pT1a patients 26482227
CancerPDF_ID11101 NASAFB2_HUMANUrine4355.1MALDI-TOFClear cell renal carcinoma Upregulated in pT1b compared to pT1a patients 26482227
CancerPDF_ID11102 NACC168_HUMANUrine4626.9MALDI-TOFClear cell renal carcinoma Upregulated in pT1b compared to pT1a patients 26482227
CancerPDF_ID11105 NANAUrine4366.9MALDI-TOFClear cell renal carcinoma Upregulated in pT1b compared to pT1a patients 26482227
CancerPDF_ID11106 NANAUrine4439.1MALDI-TOFClear cell renal carcinoma Upregulated in pT1b compared to pT1a patients 26482227
CancerPDF_ID11107 NANAUrine4751.5MALDI-TOFClear cell renal carcinoma Upregulated in pT1b compared to pT1a patients 26482227
CancerPDF_ID11108 NANAUrine5514.2MALDI-TOFClear cell renal carcinoma Upregulated in pT1b compared to pT1a patients 26482227
CancerPDF_ID11109 NANAUrine6237.8MALDI-TOFClear cell renal carcinoma Upregulated in pT1b compared to pT1a patients 26482227
CancerPDF_ID11110 NANAUrine1023.9MALDI-TOFClear cell renal carcinoma Upregulated in grade vs normal 26482227
CancerPDF_ID11111 NANAUrine1194.2MALDI-TOFClear cell renal carcinoma Upregulated in grade vs normal 26482227
CancerPDF_ID11112 NANAUrine1825.6MALDI-TOFClear cell renal carcinoma Upregulated in grade vs normal 26482227
CancerPDF_ID11114 NANAUrine3571.1MALDI-TOFClear cell renal carcinoma Upregulated in grade vs normal 26482227
CancerPDF_ID11120 NANAUrine5231.5MALDI-TOFClear cell renal carcinoma Upregulated in grade vs normal 26482227
CancerPDF_ID11121 NANAUrine1755.8MALDI-TOFClear cell renal carcinoma Upregulated in ccRCC vs normal according to primary tumor Stage 26482227
CancerPDF_ID11125 NANAUrine2660.8MALDI-TOFClear cell renal carcinoma Upregulated in ccRCC vs normal according to primary tumor Stage 26482227
CancerPDF_ID11130 NANAUrine4962.8MALDI-TOFClear cell renal carcinoma Upregulated in ccRCC vs normal according to primary tumor Stage 26482227
CancerPDF_ID11131 NANAUrine5231.5MALDI-TOFClear cell renal carcinoma Upregulated in ccRCC vs normal according to primary tumor Stage 26482227
CancerPDF_ID12676 QGLLPVLESFKVSFLSALEEYTKKLNTQApolipoprotein A-ISerumNALC-MSRenal cell carcinaoma Upregulated in cancer v/s Normal 25168216
CancerPDF_ID12677 DDPDAPLQPVTPLQLFEGRRNComplement C4SerumNALC-MSRenal cell carcinaoma Upregulated in cancer v/s Normal 25168216
CancerPDF_ID12678 DSGEGDFLAEGGGVRFibrinogen alpha chainSerumNALC-MSRenal cell carcinaoma Upregulated in cancer v/s Normal 25168216
CancerPDF_ID12679 LPILKIIPIDynein heavy chainSerumNALC-MSRenal cell carcinaoma Upregulated in cancer v/s Normal 25168216
CancerPDF_ID12680 SLAELGGHLDQQVEEFApolipoprotein A-IVSerumNALC-MSRenal cell carcinaoma Upregulated in cancer v/s Normal 25168216
CancerPDF_ID12682 APKPHAFVGSVKPutative Polycombgroup Protein ASXL1SerumNALC-MSRenal cell carcinaoma Upregulated in cancer v/s Normal 25168216
CancerPDF_ID12683 IILILAILRMajor facilitator superfamily domain-containing protein 8SerumNALC-MSRenal cell carcinaoma Upregulated in cancer v/s Normal 25168216
CancerPDF_ID12684 DFWRKMYLREPZinc finger protein 233SerumNALC-MSRenal cell carcinaoma Upregulated in cancer v/s Normal 25168216
CancerPDF_ID12685 GEGDFLAEGGGVRFibrinogen alpha chainSerumNALC-MSRenal cell carcinaoma Upregulated in cancer v/s Normal 25168216
CancerPDF_ID12686 EGDFLAEGGGVRFibrinogen alpha chainSerumNALC-MSRenal cell carcinaoma Upregulated in cancer v/s Normal 25168216
CancerPDF_ID12687 SGEGDFLAEGGGVRFibrinogen alpha chainSerumNALC-MSRenal cell carcinaoma Upregulated in cancer v/s Normal 25168216
CancerPDF_ID12691 RALAFRNASerumNALC-MSRenal cell carcinaoma Upregulated in cancer v/s Normal 25168216
CancerPDF_ID12692 NANASerumNALC-MSRenal cell carcinaoma Upregulated in cancer v/s Normal 25168216
CancerPDF_ID12693 VSFLSALEEYTKKLNTQApolipoprotein A-ISerum1970.984MALDI-TOFBreast cancer "Upregulated with the fold change of 0.57 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.88, Upregulated in BC vs healthy with 0.925 fold change" 27058005
CancerPDF_ID12694 HTFMGVVSLGSPSGEVSHPRKTAlpha-2-HS-glycoproteinSerum2326.204MALDI-TOFBreast cancer "Upregulated with the fold change of 0.58 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.25, Upregulated in BC vs healthy with 1.217 fold change" 27058005
CancerPDF_ID12695 HRIHWEComplement C3Serum877.0667MALDI-TOFBreast cancer "Upregulated with the fold change of 1.19 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.25, Upregulated in BC vs healthy with 1.065 fold change" 27058005
CancerPDF_ID12696 IHWESASLLComplement C3Serum1055.082MALDI-TOFBreast cancer "Upregulated with the fold change of 1.21 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.27, Upregulated in BC vs healthy with 1.126 fold change" 27058005
CancerPDF_ID12697 SSKITHRIHComplement C3Serum1078.125MALDI-TOFBreast cancer "Upregulated with the fold change of 1.03 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.19, Upregulated in BC vs healthy with 1.006 fold change" 27058005
CancerPDF_ID12698 SVQLTEKRMDComplement C3Serum1206.7MALDI-TOFBreast cancer "Upregulated with the fold change of 1.02 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.13, Upregulated in BC vs healthy with 1.024 fold change" 27058005
CancerPDF_ID12699 RIHWESASLLComplement C3Serum1211.694MALDI-TOFBreast cancer "Upregulated with the fold change of 1.17 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.22, Upregulated in BC vs healthy with 1.157 fold change" 27058005
CancerPDF_ID12700 HRIHWESASLLComplement C3Serum1348.755MALDI-TOFBreast cancer "Upregulated with the fold change of 1.59 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.13, Upregulated in BC vs healthy with 1.042 fold change" 27058005
CancerPDF_ID12701 THRIHWESASLLComplement C3Serum1449.804MALDI-TOFBreast cancer "Upregulated with the fold change of 1.52 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.25, Upregulated in BC vs healthy with 1.134 fold change" 27058005
CancerPDF_ID12702 SKITHRIHWESASComplement C3Serum1551.893MALDI-TOFBreast cancer "Upregulated with the fold change of 1.18 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.17, Upregulated in BC vs healthy with 1.156 fold change" 27058005
CancerPDF_ID12703 ITHRIHWESASLLComplement C3Serum1562.888MALDI-TOFBreast cancer "Upregulated with the fold change of 1.30 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.22, Upregulated in BC vs healthy with 1.134 fold change" 27058005
CancerPDF_ID12704 SVQLTEKRMDKVGKComplement C3Serum1634.944MALDI-TOFBreast cancer "Upregulated with the fold change of 0.95 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.04, Upregulated in BC vs healthy with 1.049 fold change" 27058005
CancerPDF_ID12705 KITHRIHWESASLLComplement C3Serum1690.987MALDI-TOFBreast cancer "Upregulated with the fold change of 2.19 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.36, Upregulated in BC vs healthy with 1.341 fold change" 27058005
CancerPDF_ID12706 SKITHRIHWESASLLComplement C3Serum1778.018MALDI-TOFBreast cancer "Upregulated with the fold change of 2.10 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.37, Upregulated in BC vs healthy with 1.343 fold change" 27058005
CancerPDF_ID12707 KITHRIHWESASLLRComplement C3Serum1847.095MALDI-TOFBreast cancer "Upregulated with the fold change of 1.26 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.30, Upregulated in BC vs healthy with 1.623 fold change" 27058005
CancerPDF_ID12708 SSKITHRIHWESASLLComplement C3Serum1865.05MALDI-TOFBreast cancer "Upregulated with the fold change of 2.06 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.35, Upregulated in BC vs healthy with 1.344 fold change" 27058005
CancerPDF_ID12709 SSKITHRIHWESASLLRComplement C3Serum2021.146MALDI-TOFBreast cancer "Upregulated with the fold change of 1.02 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.19, Upregulated in BC vs healthy with 1.844 fold change" 27058005
CancerPDF_ID12710 GFKSHALQLNNRQIComplement C4Serum1625.946MALDI-TOFBreast cancer "Upregulated with the fold change of 0.68 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.78, Upregulated in BC vs healthy with 0.763 fold change" 27058005
CancerPDF_ID12711 NGFKSHALQLNNRQComplement C4Serum1626.912MALDI-TOFBreast cancer "Upregulated with the fold change of 0.56 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.80, Upregulated in BC vs healthy with 0.754 fold change" 27058005
CancerPDF_ID12712 NGFKSHALQLNNRQIComplement C4Serum1739.971MALDI-TOFBreast cancer "Upregulated with the fold change of 0.76 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.83, Upregulated in BC vs healthy with 0.796 fold change" 27058005
CancerPDF_ID12713 GFKSHALQLNNRQIRComplement C4Serum1782.012MALDI-TOFBreast cancer "Upregulated with the fold change of 1.73 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.16, Upregulated in BC vs healthy with 1.092 fold change" 27058005
CancerPDF_ID12714 NGFKSHALQLNNRQIRComplement C4Serum1896.068MALDI-TOFBreast cancer "Upregulated with the fold change of 0.45 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.00, Upregulated in BC vs healthy with 0.968 fold change" 27058005
CancerPDF_ID12715 HFFFPKClusterinSerum822.485MALDI-TOFBreast cancer "Upregulated with the fold change of 0.31 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.10, Upregulated in BC vs healthy with 1.029 fold change" 27058005
CancerPDF_ID12716 FPKSRIVClusterinSerum846.533MALDI-TOFBreast cancer "Upregulated with the fold change of 0.50 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.21, Upregulated in BC vs healthy with 1.139 fold change" 27058005
CancerPDF_ID12717 HFFFPKSRIVClusterinSerum1277.758MALDI-TOFBreast cancer "Upregulated with the fold change of 0.39 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.17, Upregulated in BC vs healthy with 1.117 fold change" 27058005
CancerPDF_ID12718 RPHFFFPKSRIVClusterinSerum1530.912MALDI-TOFBreast cancer "Upregulated with the fold change of 0.26 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.16, Upregulated in BC vs healthy with 1.106 fold change" 27058005
CancerPDF_ID12719 AVPPNNSNAAEDDLPTVELQGVVPRCoagulation factor XIII A chainSerum2602.306MALDI-TOFBreast cancer "Upregulated with the fold change of 0.47 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.04, Upregulated in BC vs healthy with 1.073 fold change" 27058005
CancerPDF_ID12720 FLAEGGGVRFibrinogen alpha chainSerum905.065MALDI-TOFBreast cancer "Upregulated with the fold change of 1.28 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.35, Upregulated in BC vs healthy with 1.203 fold change" 27058005
CancerPDF_ID12721 SSSYSKQFTSSTSFibrinogen alpha chainSerum1396.795MALDI-TOFBreast cancer "Upregulated with the fold change of 0.57 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.01, Upregulated in BC vs healthy with 0.963 fold change" 27058005
CancerPDF_ID12722 NRGDSTFESKSYKMFibrinogen alpha chainSerum1665.957MALDI-TOFBreast cancer "Upregulated with the fold change of 0.65 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.06, Upregulated in BC vs healthy with 1.083 fold change" 27058005
CancerPDF_ID12723 SSSYSKQFTSSTSYNRGDSTFESFibrinogen alpha chainSerum2553.201MALDI-TOFBreast cancer "Upregulated with the fold change of 0.60 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.85, Upregulated in BC vs healthy with 0.992 fold change" 27058005
CancerPDF_ID12724 DEAGSEADHEGTHSTKRGHAKSRPVFibrinogen alpha chainSerum2659.323MALDI-TOFBreast cancer "Upregulated with the fold change of 0.73 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.88, Upregulated in BC vs healthy with 1.033 fold change" 27058005
CancerPDF_ID12725 SSSYSKQFTSSTSYNRGDSTFESKSFibrinogen alpha chainSerum2768.32MALDI-TOFBreast cancer "Upregulated with the fold change of 1.35 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.18, Upregulated in BC vs healthy with 1.074 fold change" 27058005
CancerPDF_ID12726 SSYSKQFTSSTSYNRGDSTFESKSYFibrinogen alpha chainSerum2931.376MALDI-TOFBreast cancer "Upregulated with the fold change of 0.79 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.00, Upregulated in BC vs healthy with 1.128 fold change" 27058005
CancerPDF_ID12727 KMADEAGSEADHEGTHSTKRGHAKSRPVFibrinogen alpha chainSerum3005.608MALDI-TOFBreast cancer "Upregulated with the fold change of 1.73 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 2.39, Upregulated in BC vs healthy with 2.324 fold change" 27058005
CancerPDF_ID12728 SSSYSKQFTSSTSYNRGDSTFESKSYKMFibrinogen alpha chainSerum3206.443MALDI-TOFBreast cancer "Upregulated with the fold change of 1.44 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.05, Upregulated in BC vs healthy with 0.958 fold change" 27058005
CancerPDF_ID12729 SSSYSKQFTSSTSYNRGDSTFESKSYKMAFibrinogen alpha chainSerum3277.592MALDI-TOFBreast cancer "Upregulated with the fold change of 1.43 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.11, Upregulated in BC vs healthy with 0.942 fold change" 27058005
CancerPDF_ID12730 QAGAAGSRMNFRPGVLSInter-alpha-trypsin inhibitor heavy chain H5Serum1717.941MALDI-TOFBreast cancer "Upregulated with the fold change of 0.91 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.93, Upregulated in BC vs healthy with 1.276 fold change" 27058005
CancerPDF_ID12731 QAGAAGSRMNFRPGVLSSInter-alpha-trypsin inhibitor heavy chain H5Serum1804.918MALDI-TOFBreast cancer "Upregulated with the fold change of 0.93 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.04, Upregulated in BC vs healthy with 1.080 fold change" 27058005
CancerPDF_ID12732 YLQGAKIPKPEASFSPRInter-alpha-trypsin inhibitor heavy chain H5Serum1889.031MALDI-TOFBreast cancer "Upregulated with the fold change of 1.14 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.08, Upregulated in BC vs healthy with 1.244 fold change" 27058005
CancerPDF_ID12733 YYLQGAKIPKPEASFSPRInter-alpha-trypsin inhibitor heavy chain H5Serum2051.125MALDI-TOFBreast cancer "Upregulated with the fold change of 0.80 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.02, Upregulated in BC vs healthy with 1.047 fold change" 27058005
CancerPDF_ID12734 SRQLGLPGPPDVPDHAAYHPFInter-alpha-trypsin inhibitor heavy chain H5Serum2271.203MALDI-TOFBreast cancer "Upregulated with the fold change of 0.99 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.93, Upregulated in BC vs healthy with 1.221 fold change" 27058005
CancerPDF_ID12735 NVHSGSTFFKYYLQGAKIPKPEAInter-alpha-trypsin inhibitor heavy chain H5Serum2582.393MALDI-TOFBreast cancer "Upregulated with the fold change of 0.38 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.62, Upregulated in BC vs healthy with 0.975 fold change" 27058005
CancerPDF_ID12736 GVLSSRQLGLPGPPDVPDHAAYHPFInter-alpha-trypsin inhibitor heavy chain H5Serum2627.365MALDI-TOFBreast cancer "Upregulated with the fold change of 0.51 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.86, Upregulated in BC vs healthy with 0.931 fold change" 27058005
CancerPDF_ID12737 PGVLSSRQLGLPGPPDVPDHAAYHPFInter-alpha-trypsin inhibitor heavy chain H5Serum2724.46MALDI-TOFBreast cancer "Upregulated with the fold change of 0.22 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.72, Upregulated in BC vs healthy with 1.080 fold change" 27058005
CancerPDF_ID12738 NVHSGSTFFKYYLQGAKIPKPEASFSPRInter-alpha-trypsin inhibitor heavy chain H5Serum3156.679MALDI-TOFBreast cancer "Upregulated with the fold change of 0.52 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.11, Upregulated in BC vs healthy with 1.158 fold change" 27058005
CancerPDF_ID12739 MNFRPGVLSSRQLGLPGPPDVPDHAAYHPFInter-alpha-trypsin inhibitor heavy chain H5Serum3272.752MALDI-TOFBreast cancer "Upregulated with the fold change of 0.42 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.89, Upregulated in BC vs healthy with 1.036 fold change" 27058005
CancerPDF_ID12740 MNFRPGVLSSRQLGLPGPPDVPDHAAYHPFInter-alpha-trypsin inhibitor heavy chain H5Serum3288.759MALDI-TOFBreast cancer "Upregulated with the fold change of 0.34 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.85, Upregulated in BC vs healthy with 1.126 fold change" 27058005
CancerPDF_ID12741 QAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPFInter-alpha-trypsin inhibitor heavy chain H5Serum3969.989MALDI-TOFBreast cancer "Upregulated with the fold change of 0.57 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.82, Upregulated in BC vs healthy with 1.170 fold change" 27058005
CancerPDF_ID12742 RPPGFSPFKininogen-1Serum904.5017MALDI-TOFBreast cancer "Upregulated with the fold change of 0.29 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.40, Upregulated in BC vs healthy with 0.902 fold change" 27058005
CancerPDF_ID12743 RPPGFSPFRKininogen-1Serum1060.627MALDI-TOFBreast cancer "Upregulated with the fold change of 0.79 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.82, Upregulated in BC vs healthy with 0.818 fold change" 27058005
CancerPDF_ID12744 GHKHERDQGHGHQKininogen-1Serum1522.838MALDI-TOFBreast cancer "Upregulated with the fold change of 0.81 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.88, Upregulated in BC vs healthy with 1.118 fold change" 27058005
CancerPDF_ID12745 HGHKHERDQGHGHQKininogen-1Serum1659.808MALDI-TOFBreast cancer "Upregulated with the fold change of 0.47 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.65, Upregulated in BC vs healthy with 1.231 fold change" 27058005
CancerPDF_ID12746 GHGHKHERDQGHGHQKininogen-1Serum1716.955MALDI-TOFBreast cancer "Upregulated with the fold change of 1.25 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.11, Upregulated in BC vs healthy with 1.154 fold change" 27058005
CancerPDF_ID12747 NLGHGHKHERDQGHGHQKininogen-1Serum1943.95MALDI-TOFBreast cancer "Upregulated with the fold change of 0.45 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.43, Upregulated in BC vs healthy with 1.386 fold change" 27058005
CancerPDF_ID12748 HGLGHGHEQQHGLGHGHKFKininogen-1Serum2070.011MALDI-TOFBreast cancer "Upregulated with the fold change of 0.25 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.62, Upregulated in BC vs healthy with 1.201 fold change" 27058005
CancerPDF_ID12749 HNLGHGHKHERDQGHGHQKininogen-1Serum2081.006MALDI-TOFBreast cancer "Upregulated with the fold change of 0.43 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.71, Upregulated in BC vs healthy with 1.565 fold change" 27058005
CancerPDF_ID12750 GHGLGHGHEQQHGLGHGHKFKininogen-1Serum2127.055MALDI-TOFBreast cancer "Upregulated with the fold change of 0.10 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.48, Upregulated in BC vs healthy with 1.279 fold change" 27058005
CancerPDF_ID12751 KHNLGHGHKHERDQGHGHQKininogen-1Serum2209.11MALDI-TOFBreast cancer "Upregulated with the fold change of 0.31 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.29, Upregulated in BC vs healthy with 1.499 fold change" 27058005
CancerPDF_ID12752 KHNLGHGHKHERDQGHGHQRKininogen-1Serum2365.208MALDI-TOFBreast cancer "Upregulated with the fold change of 1.62 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.87, Upregulated in BC vs healthy with 1.340 fold change" 27058005
CancerPDF_ID12753 GGPGGAGVARGGAGGGPNeurograninSerum1251.732MALDI-TOFBreast cancer "Upregulated with the fold change of 1.16 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.07, Upregulated in BC vs healthy with 1.103 fold change" 27058005
CancerPDF_ID12754 TPHPRPAPQSKPLASSGVPERIMS-binding protein-2Serum2053.134MALDI-TOFBreast cancer "Upregulated with the fold change of 0.77 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.99, Upregulated in BC vs healthy with 1.495 fold change" 27058005
CancerPDF_ID12755 DFLAEGGGVR"FGA, Isoform 2 of Fibrinogen alpha chain"Serum1025.5MALDI-TOFCervical cancer Upregulated in Cervical squamous cell carcinoma vs healthy 26282206
CancerPDF_ID12756 HRHPDEAAFFDTASTGK"FGA, Isoform 2 of Fibrinogen alpha chain"Serum1889.4MALDI-TOFCervical cancer Upregulated in Cervical squamous cell carcinoma vs healthy 26282206
CancerPDF_ID12757 NGFKSHALQLNNRQIRComplement C4eB-like Isoform 1Serum1898.9MALDI-TOFCervical cancer Upregulated in Cervical squamous cell carcinoma vs healthy 26282206
CancerPDF_ID12758 NANASerum2107.5MALDI-TOFCervical cancer Upregulated in Cervical squamous cell carcinoma vs healthy 26282206
CancerPDF_ID12764 NANASerum3885.5MALDI-TOFCervical cancer Upregulated in Cervical squamous cell carcinoma vs healthy 26282206
CancerPDF_ID12765 NANASerum4055.4MALDI-TOFCervical cancer Upregulated in Cervical squamous cell carcinoma vs healthy 26282206
CancerPDF_ID12766 NANASerum4470.9MALDI-TOFCervical cancer Upregulated in Cervical squamous cell carcinoma vs healthy 26282206
CancerPDF_ID12767 NANASerum5893.8MALDI-TOFCervical cancer Upregulated in Cervical squamous cell carcinoma vs healthy 26282206
CancerPDF_ID12768 NANASerum7773MALDI-TOFCervical cancer Upregulated in Cervical squamous cell carcinoma vs healthy 26282206
CancerPDF_ID12780 NANASerum1082.55MALDI-TOFHepatocellular carcinoma Upregulated in cancer vs Healthy 25910294
CancerPDF_ID12784 NANASerum2354.46MALDI-TOFHepatocellular carcinoma Upregulated in cancer vs Healthy 25910294
CancerPDF_ID12845 NANASerumNAMALDI-TOFAcute myeloid leukemia (AML) Upregulated in AML vs healthy 23915341
CancerPDF_ID12847 NANASerumNAMALDI-TOFAcute myeloid leukemia (AML) Upregulated in AML vs healthy 23915341
CancerPDF_ID12855 NANASerumNAMALDI-TOFAcute myeloid leukemia (AML) Upregulated in AML vs healthy 23915341
CancerPDF_ID12856 NANASerumNAMALDI-TOFAcute myeloid leukemia (AML) Upregulated in AML vs healthy 23915341
CancerPDF_ID12866 NANASerumNAMALDI-TOFAcute myeloid leukemia (AML) Upregulated in AML vs healthy 23915341
CancerPDF_ID12875 NANASerumNAMALDI-TOFAcute myeloid leukemia (AML) Upregulated in AML vs healthy 23915341
CancerPDF_ID12877 NANASerumNAMALDI-TOFAcute myeloid leukemia (AML) Upregulated in AML vs healthy 23915341
CancerPDF_ID12882 NANASerumNAMALDI-TOFAcute myeloid leukemia (AML) Upregulated in AML vs healthy 23915341
CancerPDF_ID12884 NANASerumNAMALDI-TOFAcute myeloid leukemia (AML) Upregulated in AML vs healthy 23915341
CancerPDF_ID12885 NANASerumNAMALDI-TOFAcute myeloid leukemia (AML) Upregulated in AML vs healthy 23915341
CancerPDF_ID12888 NANASerumNAMALDI-TOFAcute myeloid leukemia (AML) Upregulated in AML vs healthy 23915341
CancerPDF_ID12890 NANASerumNAMALDI-TOFAcute myeloid leukemia (AML) Upregulated in AML vs healthy 23915341
CancerPDF_ID12891 NANASerumNAMALDI-TOFBreast cancer Upregulated in breast cancer patients vs healthy 22521044
CancerPDF_ID12892 NANASerumNAMALDI-TOFBreast cancer Upregulated in breast cancer patients vs healthy 22521044
CancerPDF_ID12893 NANASerumNAMALDI-TOFBreast cancer Upregulated in breast cancer patients vs healthy 22521044
CancerPDF_ID12894 NANASerumNAMALDI-TOFBreast cancer Upregulated in breast cancer patients vs healthy 22521044
CancerPDF_ID12897 NANASerumNAMALDI-TOFBreast cancer Upregulated in breast cancer patients vs healthy 22521044
CancerPDF_ID12898 NANASerumNAMALDI-TOFBreast cancer Upregulated in breast cancer patients vs healthy 22521044
CancerPDF_ID12899 NANASerumNAMALDI-TOFBreast cancer Upregulated in breast cancer patients vs healthy 22521044
CancerPDF_ID12902 NANASerumNAMALDI-TOFBreast cancer Upregulated in breast cancer patients vs healthy 22521044
CancerPDF_ID12903 NANASerumNAMALDI-TOFBreast cancer Upregulated in breast cancer patients vs healthy 22521044
CancerPDF_ID12909 NANASerumNAMALDI-TOFBreast cancer Upregulated in breast cancer patients vs healthy 22521044
CancerPDF_ID12910 NANASerumNAMALDI-TOFBreast cancer Upregulated in breast cancer patients vs healthy 22521044
CancerPDF_ID12911 NANASerumNAMALDI-TOFBreast cancer Upregulated in breast cancer patients vs healthy 22521044
CancerPDF_ID12912 NANASerumNAMALDI-TOFBreast cancer Upregulated in breast cancer patients vs healthy 22521044
CancerPDF_ID12913 NANASerumNAMALDI-TOFBreast cancer Upregulated in breast cancer patients vs healthy 22521044
CancerPDF_ID12914 NANASerumNAMALDI-TOFBreast cancer Upregulated in breast cancer patients vs healthy 22521044
CancerPDF_ID12915 NANASerum"3,316.09"MALDI-TOFGastric cancer Upregulated in gastric cancer vs healthy 21739109
CancerPDF_ID12919 NANASerum"6,622.59"MALDI-TOFGastric cancer Upregulated in Gastric cancer vs healthy 21739109
CancerPDF_ID12923 NANASerum"3,217.15"MALDI-TOFGastric cancer Upregulated in Gastric cancer vs healthy 21739109
CancerPDF_ID14044 NANASerum1081.19MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14047 NANASerum1119.63MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14048 NANASerum1128.08MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14059 NANASerum1302.12MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14060 NANASerum1309.55MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14061 NANASerum1310.35MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14063 NANASerum1346.96MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14072 NANASerum1469.88MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14074 NANASerum1491.34MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14077 NANASerum1513.8MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14099 NANASerum1710.37MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14100 NANASerum1720.96MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14101 NANASerum1738.52MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14102 NANASerum1751.72MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14103 NANASerum1759.67MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14104 NANASerum1775.86MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14105 NANASerum1791.07MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14106 NANASerum1797.47MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14107 NANASerum1805.94MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14108 NANASerum1812.88MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14109 NANASerum1831.4MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14110 NANASerum1837.36MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14111 NANASerum1846.16MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14112 NANASerum1883.63MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14113 NANASerum1899.32MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14114 NANASerum1905.69MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14115 NANASerum1915.06MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14116 NANASerum1923.03MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14117 NANASerum1935.12MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14118 NANASerum1944.57MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14119 NANASerum1953.46MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14120 NANASerum1962.12MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14122 NANASerum1990.97MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14124 NANASerum2000.28MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14126 NANASerum2029.33MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14127 NANASerum2036.45MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14128 NANASerum2041.92MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14129 NANASerum2050.28MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14130 NANASerum2065.3MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14131 NANASerum2079.44MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14132 NANASerum2087.4MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14133 NANASerum2098.68MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14134 NANASerum2110MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14136 NANASerum2134.89MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14137 NANASerum2145.66MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14139 NANASerum2168.78MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14140 NANASerum2181.09MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14141 NANASerum2194.14MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14142 NANASerum2202.13MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14143 NANASerum2226.1MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14144 NANASerum2236.48MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14145 NANASerum2246.03MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14146 NANASerum2261.33MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14148 NANASerum2270.11MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14149 NANASerum2284.19MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14150 NANASerum2291.61MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14151 NANASerum2302.52MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14152 NANASerum2309.6MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14153 NANASerum2319.75MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14155 NANASerum2374.11MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14156 NANASerum2381.51MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14158 NANASerum2407.58MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14159 NANASerum2425.66MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14160 NANASerum2441.68MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14161 NANASerum2457.85MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14165 NANASerum2547.82MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14166 NANASerum2568.39MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14167 NANASerum2581.12MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14168 NANASerum2590.93MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14169 NANASerum2598.8MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14170 NANASerum2614.92MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14171 NANASerum2628.53MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14172 NANASerum2645.73MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14173 NANASerum2661.89MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14179 NANASerum2738.96MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14180 NANASerum2752.7MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14181 NANASerum2768.93MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14183 NANASerum2797.85MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14185 NANASerum2830.42MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14188 NANASerum2913.13MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14196 NANASerum3102.33MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14197 NANASerum3169.15MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14198 NANASerum3177.41MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14199 NANASerum3192.36MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14209 NANASerum3285.31MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14211 NANASerum3304.01MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14214 NANASerum3320.99MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14215 NANASerum3339.94MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14216 NANASerum3390.86MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14217 NANASerum3409.35MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14220 NANASerum3516.41MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14221 NANASerum3534.25MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14222 NANASerum3551.67MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14223 NANASerum3706.99MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14224 NANASerum3797.42MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14225 NANASerum3822.52MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14226 NANASerum3838.14MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14228 NANASerum3961.49MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14229 NANASerum3968.83MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14230 NANASerum3976.47MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14231 NANASerum3984.71MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14233 NANASerum3992.66MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14234 NANASerum4008.74MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14236 NANASerum4073.65MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14237 NANASerum4085.79MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14240 NANASerum4149.54MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14247 NANASerum4237.13MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14250 NANASerum4286.89MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14251 NANASerum4292.48MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14252 NANASerum4298.29MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14253 NANASerum4304.27MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14254 NANASerum4314.16MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14255 NANASerum4319.57MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14256 NANASerum4320.42MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14257 NANASerum4321.32MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14258 NANASerum4327.41MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14259 NANASerum4451.95MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14260 NANASerum4480.21MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14262 NANASerum4651.99MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14263 NANASerum4792.96MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14264 NANASerum4809.18MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14266 NANASerum4993.25MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14267 NANASerum5008.32MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14268 NANASerum5022.55MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14269 NANASerum5026.15MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14270 NANASerum5032.97MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14271 NANASerum5049.86MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14272 NANASerum5149.58MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14273 NANASerum5163.83MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14274 NANASerum5174.29MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14278 NANASerum5346.44MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14280 NANASerum5358.43MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14297 NANASerum8597.13MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850
CancerPDF_ID14298 NANASerum9287.29MALDI-TOFGastric cancer Upregulated in cancer vs healthy 26376850