A database of FDA approved therapeutic peptides and proteins
| This page displays user query in tabular form. |
1064 details |
| Primary information | |
|---|---|
| ThPP ID | Th1011 |
| Therapeutic Peptide/Protein Name | Darbepoetin alfa |
| Sequence | APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta |
| Functional Classification | Ib |
| Molecular Weight | 18396.1 |
| Chemical Formula | C815H1317N233O241S5 |
| Isoelectric Point | 8.75 |
| Hydrophobicity | -0.188 |
| Melting Point (℃) | 53 |
| Half Life | N.A. |
| Description | Human erythropoietin with 2 amino acid substitutions to enhance glycosylation (5 N-linked chains), 165 residues (MW 37kD) produced in CHO cells by recombinant DNA technology. |
| Indication/Disease | For treating anemia (from renal transplants or certain HIV treatment). |
| Pharmacodynamics | Darbepoetin alfa is used in treating anemia. It is involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass. |
| Mechanism of Action | Darbepoetin alfa stimulates erythropoiesis by the same mechanism as endogenous erythropoietin, it interacts with progenitor stem cells to increase red cell production. Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Anti-anemic Agents |
| Patents Number | CA2165694 |
| Date of Issue | 18/03/03 |
| Date of Expiry | 15/10/10 |
| Drug Interaction | N.A. |
| Target | Erythropoietin receptor |
| Information of corresponding available drug in the market | |
| Brand Name | Aranesp |
| Company | Amgen Inc |
| Brand Discription | Aranesp is an erythropoiesis-stimulating protein that is produced in Chinese hamster ovary cells by recombinant DNA technology. Aranesp is a 165-amino acid protein (37,000 daltons) that differs from recombinant human erythropoietin in containing 5 N-linke |
| Prescribed for | Used to treat anemia. |
| Chemical Name | N.A. |
| Formulation | Each 1 mL contains polysorbate 80 (0.05 mg), sodium chloride (8.18 mg), sodium phosphate dibasic anhydrous (0.66 mg), and sodium phosphate monobasic monohydrate (2.12 mg) in Water for Injection, USP (pH 6.2 ± 0.2). |
| Physcial Appearnce | Sterile, colorless, preservative-free solution containing polysorbate |
| Route of Administration | Intravenous or Subcutaneous administration |
| Recommended Dosage | N.A. |
| Contraindication | Allergic |
| Side Effects | Fever, chills, body aches, flu symptoms; feeling like you might pass out; easy bruising, unusual bleeding (nose, mouth, vagina, or rectum), purple or red pinpoint spots under your skin; seizure (black-out or convulsions); or dangerously high blood pressure. |
| Useful Link | http://www.aranesp.com/ |
| PubMed ID | 23847411, 23338536, 23325012, 23243269, 22803621, 22192713, 20140276, 18837016, 16179960 |
| 3-D Structure | Th1011 (View) or (Download) |