A database of FDA approved therapeutic peptides and proteins
This page displays user query in tabular form. |
1075 details |
Primary information | |
---|---|
ThPP ID | Th1013 |
Therapeutic Peptide/Protein Name | Epoetin alfa |
Sequence | APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA view full sequnce in fasta |
Functional Classification | Ib |
Molecular Weight | 18396.1 |
Chemical Formula | C815H1317N233O241S5 |
Isoelectric Point | 8.75 |
Hydrophobicity | N.A. |
Melting Point (℃) | 53 |
Half Life | N.A. |
Description | It is recombinant human erythropoietin which is produced by CHO cells. |
Indication/Disease | For treatment of anemia (from renal transplants or certain HIV treatment). |
Pharmacodynamics | Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass. |
Mechanism of Action | Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation. |
Toxicity | N.A. |
Metabolism | N.A. |
Absorption | N.A. |
Volume of Distribution | N.A. |
Clearance | N.A. |
Categories | N.A. |
Patents Number | N.A. |
Date of Issue | N.A. |
Date of Expiry | N.A. |
Drug Interaction | N.A. |
Target | N.A. |
Information of corresponding available drug in the market | |
Brand Name | Epofit |
Company | Intas pharma |
Brand Discription | N.A. |
Prescribed for | N.A. |
Chemical Name | N.A. |
Formulation | N.A. |
Physcial Appearnce | N.A. |
Route of Administration | N.A. |
Recommended Dosage | N.A. |
Contraindication | N.A. |
Side Effects | N.A. |
Useful Link | N.A. |
PubMed ID | 20369312, 18208642 |
3-D Structure | Th1013 (View) or (Download) |