A database of FDA approved therapeutic peptides and proteins
| This page displays user query in tabular form. |
1110 details |
| Primary information | |
|---|---|
| ThPP ID | Th1015 |
| Therapeutic Peptide/Protein Name | Interferon alfa-n3 |
| Sequence | Alpha-2A:CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQE view full sequnce in fasta |
| Functional Classification | Ib |
| Molecular Weight | N.A. |
| Chemical Formula | N.A. |
| Isoelectric Point | 5.99 |
| Hydrophobicity | N.A. |
| Melting Point (℃) | 61 |
| Half Life | N.A. |
| Description | Purified, natural human interferon alpha proteins consisting of 3 forms or polymorphisms including 2a, 2b and 2c. It consists of 166 residues(MW range from 16 kD to 27 kD) out of which some are glycosylated. |
| Indication/Disease | For the intralesional treatment of refractory or recurring external condylomata acuminata. |
| Pharmacodynamics | Interferon alfa-n3 upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes and make the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin, neopterin and protein kinase R. |
| Mechanism of Action | Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Immunosuppressive Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2 |
| Information of corresponding available drug in the market | |
| Brand Name | Alferon |
| Company | Interferon Sciences Inc. |
| Brand Discription | Alferon solution is an interferon |
| Prescribed for | Used to treat genital warts (condylomata acuminata) |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearnce | Solution |
| Route of Administration | Injection |
| Recommended Dosage | 0.05 mL (250,000 international units) per wart, injected intralesionally twice a week for up to 8 weeks. The maximum recommended dosage per treatment session is 0.5 mL (2.5 million international units). |
| Contraindication | Allergic to any ingredient in Alferon solution, including egg protein or neomycin |
| Side Effects | Appetite loss; changes in taste or hearing; chills; diarrhea; fatigue; flu-like symptoms; headache; muscle and joint pain; nausea; pain or other reaction at the site of injection; stomach pain; vomiting. |
| Useful Link | http://www.webmd.com/drugs/2/drug-5287/alferon-n-inj/details |
| PubMed ID | 10868311 |
| 3-D Structure | Th1015 (View) or (Download) |