A database of FDA approved therapeutic peptides and proteins
This page displays user query in tabular form. |
1111 details |
Primary information | |
---|---|
ThPP ID | Th1015 |
Therapeutic Peptide/Protein Name | Interferon alfa-n3 |
Sequence | Alpha-2A:CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQE view full sequnce in fasta |
Functional Classification | Ib |
Molecular Weight | N.A. |
Chemical Formula | N.A. |
Isoelectric Point | 5.99 |
Hydrophobicity | N.A. |
Melting Point (℃) | 61 |
Half Life | N.A. |
Description | Purified, natural human interferon alpha proteins consisting of 3 forms or polymorphisms including 2a, 2b and 2c. It consists of 166 residues(MW range from 16 kD to 27 kD) out of which some are glycosylated. |
Indication/Disease | For the intralesional treatment of refractory or recurring external condylomata acuminata. |
Pharmacodynamics | Interferon alfa-n3 upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes and make the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin, neopterin and protein kinase R. |
Mechanism of Action | Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta. |
Toxicity | N.A. |
Metabolism | N.A. |
Absorption | N.A. |
Volume of Distribution | N.A. |
Clearance | N.A. |
Categories | Immunosuppressive Agents |
Patents Number | N.A. |
Date of Issue | N.A. |
Date of Expiry | N.A. |
Drug Interaction | N.A. |
Target | N.A. |
Information of corresponding available drug in the market | |
Brand Name | N.A. |
Company | N.A. |
Brand Discription | N.A. |
Prescribed for | N.A. |
Chemical Name | N.A. |
Formulation | N.A. |
Physcial Appearnce | N.A. |
Route of Administration | N.A. |
Recommended Dosage | N.A. |
Contraindication | N.A. |
Side Effects | Rash; hives; difficulty breathing; tightness in the chest; swelling of the mouth, face, lips, or tongue; black, tarry stools; bloody diarrhea; chest pain; dark urine or changes in amount of urine; depression; difficulty sleeping; dizziness; drowsiness; intolerance to heat or cold; irregular heartbeat; one-sided weakness (arm, leg); persistent sore throat; poor coordination; pounding in the chest; psychotic or manic behavior; seizures; severe stomach/abdominal pain; suicidal thoughts; tingling hands or feet; unusual bleeding/bruising; unusual increase in thirst; vision changes; vomiting blood; yellowing of the skin or eyes. |
Useful Link | http://www.drugs.com/cdi/interferon-alfa-n3-solution.html |
PubMed ID | 10868311 |
3-D Structure | Th1015 (View) or (Download) |