A database of FDA approved therapeutic peptides and proteins
This page displays user query in tabular form. |
1121 details |
Primary information | |
---|---|
ThPP ID | Th1017 |
Therapeutic Peptide/Protein Name | Sargramostim |
Sequence | APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQ view full sequnce in fasta |
Functional Classification | Ib |
Molecular Weight | 14434.5 |
Chemical Formula | C639H1006N168O196S8 |
Isoelectric Point | 5.05 |
Hydrophobicity | N.A. |
Melting Point (℃) | N.A. |
Half Life | N.A. |
Description | Sargramostim (127 residue glycoprotein) is a human recombinant granulocyte macrophage colony-stimulating factor expressed in yeast system. Substitution of Leu23 leads to a difference from native protein. |
Indication/Disease | Used to treat cancer and in bone marrow transplant |
Pharmacodynamics | Sargramostim is used in the treatment of bone marrow transplant recipients or those exposed to chemotherapy and recovering from acute myelogenous leukemia, Leukine or GM-CSF is a hematopoietic growth factor which stimulates the survival, clonal expansion (proliferation) and differentiation of hematopoietic progenitor cells. GM-CSF is also capable of activating mature granulocytes and macrophages. After a bone marrow transplant or chemotherapy, patients have a reduced capacity to produce red and white blood cells. Supplementing them with external sources of GM-CSF helps bring the level of neutrophils back to normal so that they can better fight infections. |
Mechanism of Action | Sargramostim binds to the Granulocyte-macrophage colony stimulating factor receptor which stimulates a JAK2 STAT1/STAT3 signal transduction pathway which leads to the production of hemopoietic cells and neutrophils |
Toxicity | N.A. |
Metabolism | N.A. |
Absorption | N.A. |
Volume of Distribution | N.A. |
Clearance | 431 mL/min/m2 [Normal people with lyophilized LEUKINE (IV)] |
Categories | Immunosuppressive Agents |
Patents Number | N.A. |
Date of Issue | N.A. |
Date of Expiry | N.A. |
Drug Interaction | N.A. |
Target | N.A. |
Information of corresponding available drug in the market | |
Brand Name | N.A. |
Company | N.A. |
Brand Discription | N.A. |
Prescribed for | N.A. |
Chemical Name | N.A. |
Formulation | N.A. |
Physcial Appearnce | N.A. |
Route of Administration | N.A. |
Recommended Dosage | N.A. |
Contraindication | N.A. |
Side Effects | Occasionally irritation at the injection site. |
Useful Link | http://www.igenericdrugs.com/?s=leucomax%20%28novartis%29 |
PubMed ID | 25416452, 25270293, 15583528, 25270293, 27838641, 27783330, 27576783, 27619199, 27141384 |
3-D Structure | Th1017 (View) or (Download) |