A database of FDA approved therapeutic peptides and proteins
| This page displays user query in tabular form. |
1148 details |
| Primary information | |
|---|---|
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | CA2124690 |
| Date of Issue | 11/09/07 |
| Date of Expiry | 01/10/13 |
| Drug Interaction | N.A. |
| Target | Coagulation factor X,Coagulation factor IX,von Willebrand factor,Phytanoyl-CoA dioxygenase, peroxisomal,Asialoglycoprotein receptor 2,78 kDa glucose-regulated protein,Calreticulin,Calnexin,Protein ERGIC-53,Prolow-density lipoprotein receptor-related protein 1,Multiple coagulation factor deficiency protein 2 |
| Information of corresponding available drug in the market | |
| Brand Name | Advate |
| Company | N.A. |
| Brand Discription | Advate contains antihemophilic factor, a naturally occurring protein in the blood that helps blood to clot. Advate works by temporarily raising levels of factor VIII in the blood to aid in clotting. |
| Prescribed for | ADVATE is a medicine used to replace clotting factor that is missing in people with hemophilia A. It is used to prevent and control bleeding in adults and children (0-16 years) with hemophilia A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearnce | Powder form |
| Route of Administration | Intravenous Injection |
| Recommended Dosage | Dose (IU) = body weight (kg) _ Desired Factor VIII Rise (IU/dL or % of normal) _ 0.5 (IU/kg per IU/dL). So example, assuming assuming patient's baseline Factor VIII level is < 1% of normal = A dose of 1750 IU ADVATE administered to a 70 kg patient should be expected to result in a peak post-infusion Factor VIII increase of 1750 IU × {[2 IU/dL]/[IU/kg]}/[70 kg] = 50 IU/dL (50% of normal). |
| Contraindication | Patients who have life-threatening hypersensitivity reactions, including anaphylaxis, to mouse or hamster protein or other constituents of the product. |
| Side Effects | Chest pain; easy bruising, increased bleeding episodes; or bleeding from a wound or where the medicine was injected. |
| Useful Link | http://www.advate.com/assets/pdf/advate_iri_pi.pdf |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |