A database of FDA approved therapeutic peptides and proteins
| This page displays user query in tabular form. |
1151 details |
| Primary information | |
|---|---|
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market | |
| Brand Name | Alphanate |
| Company | N.A. |
| Brand Discription | Alphanate(Solvent Detergent / Heat Treated) is a single dose, sterile, lyophilized concentrate of Factor VIII intended for intravenous administration in the treatment of hemophilia A, or acquired Factor VIII deficiency. Alphanate is prepared from pooled h |
| Prescribed for | It is used for preventing and controlling bleeding in adult patients with hemophilia A. It is also used to control certain types of bleeding episodes (eg, due to injury or surgery) in patients with von Willebrand disease. |
| Chemical Name | N.A. |
| Formulation | When reconstituted with the appropriate volume of Sterile Water for Injection, USP, Alphanate contains 0.3 - 0.9 g Albumin (Human)/100 mL; NMT 5 mmol calcium/L; NMT 750 µg glycine/IU FVIIIC; NMT 1.0 U heparin/mL; 10 - 40 mmol histidine/L; NMT 0.1 mg imida |
| Physcial Appearnce | Lyophilized powder |
| Route of Administration | Intravenous Injection |
| Recommended Dosage | Bodyweight (in kg) X 0.50 lU/kg X Factor VIII Increase Desired (Percent) = Number of Factor VIII:C IU Required. |
| Contraindication | Contraindicated in patients who have manifested life-threatening immediate hypersensitivity reactions including anaphylaxis to any components of the product. |
| Side Effects | Rash; hives; itching; difficulty breathing; tightness in the chest; swelling of the mouth, face, lips, or tongue); back or stomach pain; calf pain, swelling, or tenderness; chest pain; coughing up blood; dark urine; fever or chills; new or worsening bruis |
| Useful Link | http://www.rxlist.com/alphanate-drug.htm |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |