A database of FDA approved therapeutic peptides and proteins
| This page displays user query in tabular form. |
1153 details |
| Primary information | |
|---|---|
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market | |
| Brand Name | Bioclate |
| Company | Baxter Healthcare Corporation, Hyland Division and Genetics Institute, Inc. |
| Brand Discription | Bioclate is a glycoprotein synthesized by a genetically engineered Chinese Hamster Ovary cell line. In culture the CHO cell line secretes recombinant antihemophilic factor into the cell culture medium. The rAHF is purified from the culture medium utilizin |
| Prescribed for | To treat or prevent bleeding episodes in adults and children with hemophilia A. It is also used to control bleeding related to surgery or dentistry in a person with hemophilia. |
| Chemical Name | N.A. |
| Formulation | Biocolate is available in single-dose bottles which contain nominally 250, 500 and 1000 International Units per bottle.When reconstituted with the appropriate volume of diluent, it contains the following stabilizers in maximum amounts: 12.5 mg/mL Albumin |
| Physcial Appearnce | Sterile, nonpyrogenic, off-white to faint yellow, lyophilized powder |
| Route of Administration | Intravenous infusion |
| Recommended Dosage | N.A. |
| Contraindication | Allergic |
| Side Effects | Chest pain; easy bruising, increased bleeding episodes; or bleeding from a wound or where the medicine was injected. |
| Useful Link | http://www.drugs.com/mtm/bioclate-recombinant.html |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |