A database of FDA approved therapeutic peptides and proteins
| This page displays user query in tabular form. |
1157 details |
| Primary information | |
|---|---|
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market | |
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearnce | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | Dizziness, rash , unusual taste in the mouth , mild increase in blood pressure |
| Useful Link | http://www.drugs.com/pro/helixate-fs.html |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |