A database of FDA approved therapeutic peptides and proteins
| This page displays user query in tabular form. |
1159 details |
| Primary information | |
|---|---|
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market | |
| Brand Name | Hemofil M |
| Company | N.A. |
| Brand Discription | Hemofil M is a human clotting factor derived from pooled human plasma. It works by increasing the amount of clotting factor VII in the blood, helping the blood form clots and stop bleeding |
| Prescribed for | Preventing and controlling bleeding in patients with hemophilia A, including in surgical settings. |
| Chemical Name | N.A. |
| Formulation | HEMOFIL is available as single dose bottles that contain nominally 250 (NDC 0944-2930-01), 500 (NDC 0944-2931-01), 1000 (NDC 0944-2932-01), and 1700 (NDC 0944-2933-01) IU per bottle. Each bottle is labeled with the potency in International Units, and is p |
| Physcial Appearnce | Dry concentrate |
| Route of Administration | Intravenous Injection |
| Recommended Dosage | The expected in vivo peak AHF level, expressed as IU/dL of plasma or percent of normal, can be calculated by multiplying the dose administered per kg body weight (IU/kg) by two. |
| Contraindication | Allergic |
| Side Effects | Rash; hives; itching; difficulty breathing; flushing; tightness in the chest; swelling of the mouth, face, lips, or tongue; wheezing; chest pain; fainting; nausea; severe or persistent dizziness or light-headedness; shortness of breath. |
| Useful Link | http://www.drugs.com/cdi/hemofil-m.html |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |