A database of FDA approved therapeutic peptides and proteins
| This page displays user query in tabular form. |
1226 details |
| Primary information | |
|---|---|
| ThPP ID | Th1030 |
| Therapeutic Peptide/Protein Name | Interferon gamma-1b |
| Sequence | CYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQS view full sequnce in fasta |
| Functional Classification | Ib |
| Molecular Weight | 17145.6 |
| Chemical Formula | C761H1206N214O225S6 |
| Isoelectric Point | 9.54 |
| Hydrophobicity | -0.823 |
| Melting Point (℃) | 61 |
| Half Life | N.A. |
| Description | Human Interferon gamma-1b (140 residues), produced from E. coli. Production of Actimmune is achieved by fermentation of a genetically engineered Escherichia coli bacterium containing the DNA which encodes for the human protein. Purification of the product is achieved by conventional column chromatography. The sequence displayed is a cDNA sequence which codes for human interferon gamma, as described by Gray et. al. and not specifically interferon gamma 1b. |
| Indication/Disease | To treat Chronic granulomatous disease and Osteopetrosis. |
| Pharmacodynamics | IFN gamma stimulates expression of the immunoglobulin heavy chain C gamma 3 and C gamma 2a germline transcripts in B cells. Many components of the antigen presentation pathways are also up-regulated by interferon gamma. It is also a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of type I interferons. Interferon gamma may also help the body regulate the activity of fibroblasts. By directly blocking the multiplication of fibroblasts and inhibiting the production and action of TGF-b, a potent scar-inducing molecule, Interferon gamma-1b may prevent excessive scarring. |
| Mechanism of Action | It binds directly to the type II interferon gamma receptor IFNGR1, leading to a complex of IFNGR1 and IFNGR2. This activates JAK1 and JAK2 kinases which form a STAT1 docking site. This leads to STAT1 phosphorylation, nuclear translocation and initiation of gene transcription of multiple immune-related genes. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Immunosuppressive Agents |
| Patents Number | US6936695 |
| Date of Issue | 30/08/05 |
| Date of Expiry | 30/08/22 |
| Drug Interaction | N.A. |
| Target | Interferon gamma receptor 1,Interferon gamma receptor 2 |
| Information of corresponding available drug in the market | |
| Brand Name | Actimmune |
| Company | InterMune Inc |
| Brand Discription | ACTIMMUNE, a biologic response modifier, is a single-chain polypeptide containing 140 amino acids. Production is achieved by fermentation of a genetically engineered Escherichia coli bacterium containing the DNA which encodes for the human protein. Purifi |
| Prescribed for | Used for reducing the number and severity of infections associated with chronic granulomatous disease. It is also used to delay the progression of severe, life-threatening bone density disease |
| Chemical Name | N.A. |
| Formulation | Each 0.5 mL of ACTIMMUNE contains 100 mcg (2 million IU) of Interferon gamma-1 b formulated in 20 mg mannitol, 0.36 mg sodium succinate, 0.05 mg polysorbate 20 and Sterile Water for Injection. |
| Physcial Appearnce | Sterile, clear, colorless solution |
| Route of Administration | Subcutaneous Injection |
| Recommended Dosage | Dose for the treatment of patients with Chronic Granulomatous Disease and severe, malignant osteopetrosis is 50 mcg/m2(1 million IU/m2) for patients whose body surface area is greater than 0.5 m2 and 1.5 mcg/kg/dose for patients whose body surface area is equal to or less than 0.5 m2. |
| Contraindication | Hypersensitivity |
| Side Effects | Diarrhea; fatigue; flu-like symptoms (eg, low-grade fever, chills, general body discomfort); headache; joint pain; muscle pain; nausea; pain, redness, or swelling at the injection site; tiredness; vomiting; weakness. Severe side efects include Severe dizziness and troubled breathing. |
| Useful Link | http://www.drugs.com/cdi/actimmune.html |
| PubMed ID | 25470089, 25335475, 24576196, 19570573, 18644457, 18314182, 17128525, 16637863, 16611657 |
| 3-D Structure | Th1030 (View) or (Download) |