A database of FDA approved therapeutic peptides and proteins
| This page displays user query in tabular form. |
1260 details |
| Primary information | |
|---|---|
| ThPP ID | Th1037 |
| Therapeutic Peptide/Protein Name | Botulinum Toxin Type B |
| Sequence | MPVTINNFNYNDPIDNNNIIMMEPPFARGTGRYYKAFKITDRIWIIPERY view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 150804 |
| Chemical Formula | C690H1115N177O202S6 |
| Isoelectric Point | N.A. |
| Hydrophobicity | N.A. |
| Melting Point (℃) | N.A. |
| Half Life | N.A. |
| Description | Neurotoxin produced by fermentation of clostridium botulinum type B. The protein exists in noncovalent association with hemagglutinin and nonhemagglutinin proteins as a neurotoxin complex. The neurotoxin complex is recovered from the fermentation process. |
| Indication/Disease | To treat patients with cervical dystonia to reduce the severity of abnormal head position and neck pain associated with cervical dystonia. |
| Pharmacodynamics | Botulinum Toxin Type B inhibits acetylcholine release at the neuromuscular junction via a three stage process: 1) Heavy Chain mediated neurospecific binding of the toxin, 2) internalization of the toxin by receptor-mediated endocytosis, and 3) ATP and pH dependent translocation of the Light Chain to the neuronal cytosol where it acts as a zinc-dependent endoprotease cleaving polypeptides essential for neurotransmitter release. |
| Mechanism of Action | Botulinum Toxin Type B binds and cleaves the synaptic Vesicle Associated Membrane Protein (VAMP, also known as synaptobrevin) which is a component of the protein complex responsible for docking and fusion of the synaptic vesicle to the presynaptic membrane, a necessary step to neurotransmitter release. |
| Toxicity | One unit of Botulinum Toxin Type B corresponds to the calculated median lethal intraperitoneal dose (LD50) in mice. |
| Metabolism | N.A. |
| Absorption | Botulinum Toxin Type B is not expected to be present in the peripheral blood at measurable levels following IM injection at the recommended doses as pharmacokinetic or ADME studies were not performed |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Antidystonic Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | Vesicle-associated membrane protein 2,Vesicle-associated membrane protein 1,Synaptotagmin-2 |
| Information of corresponding available drug in the market | |
| Brand Name | Myobloc |
| Company | Solstice Neurosciences |
| Brand Discription | MYOBLOC injection is a sterile liquid formulation of a purified neurotoxin that acts at the neuromuscular junction to produce flaccid paralysis. The neurotoxin is produced by fermentation of the bacterium Clostridium botulinum type B (Bean strain) and exi |
| Prescribed for | It is used for reducing the severity of abnormal head position and neck pain associated with a certain neck problem (cervical dystonia) |
| Chemical Name | N.A. |
| Formulation | It is supplied in 3.5-mL glass vials. Each single-use vial of formulated MYOBLOC contains 5,000 Units of botulinum toxin type B per milliliter in 0.05% human serum albumin, 0.01 M sodium succinate, and 0.1 M sodium chloride at approximately pH 5.6. |
| Physcial Appearnce | Clear and colorless to light-yellow Sterile injectable solution |
| Route of Administration | Injection |
| Recommended Dosage | The recommended initial dose of MYOBLOC (botulinum toxin type b) for patients with a prior history of tolerating botulinum toxin injections is 2,500 to 5,000 Units divided among affected muscles. Patients without a prior history of tolerating botulinum toxin injections should receive lower initial dose. |
| Contraindication | MYOBLOC is contraindicated in patients with a known hypersensitivity to any botulinum toxin preparation or to any of the components in the formulation and in patients with infection at the proposed injection site |
| Side Effects | Anxiety; back pain; dizziness; drowsiness; dry eyes; dry mouth; flu-like symptoms; headache; increased cough; indigestion; nausea; neck pain; pain, redness, swelling, or tenderness at the injection site; runny nose; sensitivity to light; sweating; upset stomach. |
| Useful Link | http://www.rxlist.com/myobloc-drug.html |
| PubMed ID | 10534247, 10534247 |
| 3-D Structure | Th1037 (View) or (Download) |