A database of FDA approved therapeutic peptides and proteins
| This page displays user query in tabular form. |
1269 details |
| Primary information | |
|---|---|
| ThPP ID | Th1039 |
| Therapeutic Peptide/Protein Name | Lutropin alfa |
| Sequence | Alpha Chain: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAY view full sequnce in fasta |
| Functional Classification | Ib |
| Molecular Weight | 30000 |
| Chemical Formula | C1014H1609N287O294S27 |
| Isoelectric Point | 8.44 |
| Hydrophobicity | -0.063 |
| Melting Point (℃) | 55 |
| Half Life | 4.4 hours (mammalian reticulocytes, in vitro) |
| Description | Lutropin alfa is a recombinant human luteinizing hormone produced in yeast with 2 subunits, alpha = 92 residues, beta = 121 residues. It is a heterodimeric glycoprotein. Each monomeric unit is a glycoprotein molecule. In females, an acute rise of LH(LH surge) triggers ovulation and the development of the corpus luteum. In males, it stimulates Leydig cell production of testosterone. Lutropin alfa was the first and only recombinant human form of luteinizing hormone (LH) developed for use in the stimulation of follicular development. |
| Indication/Disease | For treatment of female infertility |
| Pharmacodynamics | Used to facilitate female conception, lutropin alfa performs the same actions as luteinizing hormone, which is normally produced in the pituitary gland. Lutropin is usually given in combination with follitropin alfa. In females, a LH surge about halfway through the menstrual cycle triggers the onset of ovulation. LH also induces the ovulated follicle to become a corpus luteum, which then secretes progesterone. |
| Mechanism of Action | Binds to the luteinizing hormone receptor which then activates adenylate cylcase through G protein mediation. Adenylate cyclase then activates many other pathways leading to steroid hormone production and other follicle maturation processes. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | 10 L |
| Clearance | 2-3 L/h [healthy female following subcutaneous administration]. Total body clearance is approximately 2 to 3 L/h with less than 5 percent of the dose being excreted unchanged renally. |
| Categories | Fertility Agents |
| Patents Number | US5767251 |
| Date of Issue | 16/06/95 |
| Date of Expiry | 16/06/15 |
| Drug Interaction | Other drugs may interact with lutropin alfa, including prescription and over-the-counter medicines, vitamins, and herbal products |
| Target | Lutropin-choriogonadotropic hormone receptor |
| Information of corresponding available drug in the market | |
| Brand Name | Luveris |
| Company | Serono |
| Brand Discription | Luveris is a purified form of a hormone called luteinizing hormone, or LH. This hormone is important in the development of follicles (eggs) produced by the ovaries in women. |
| Prescribed for | Luveris is used together with follitropin alfa to treat infertility in women with LH deficiency. |
| Chemical Name | N.A. |
| Formulation | One vial contains 75 IU of lutropin alfa (recombinant human Luteinising Hormone {r-hLH}) and following excipeint is present; Powder:Sucrose,Disodium phosphate dihydrate,Sodium dihydrogen phosphate monohydrate,Polysorbate 20,Phosphoric acid, concentrated ( |
| Physcial Appearnce | White lyophilised pellet withg clear colourless solvent to make solution |
| Route of Administration | Subcutaneous (Subcutaneous) administration |
| Recommended Dosage | It is recommended that 75 IU Luveris be concomitantly administered subcutaneously with 75 IU to 150 IU Gonal-f as two separate injections in the initial treatment cycle |
| Contraindication | Hypersensitivity |
| Side Effects | Nausea, stomach pain, diarrhea, constipation, gas; pelvic pain, menstrual cramps; breast pain; headache; pain or irritation where the injection was given; tired feeling; or cold symptoms such as stuffy nose, sneezing, sore throat. |
| Useful Link | http://www.drugs.com/luveris.html |
| PubMed ID | 20238314, 18627209 |
| 3-D Structure | Th1039 (View) or (Download) |