A database of FDA approved therapeutic peptides and proteins
This page displays user query in tabular form. |
1289 details |
Primary information | |
---|---|
ThPP ID | Th1042 |
Therapeutic Peptide/Protein Name | Collagenase |
Sequence | MKRKCLSKRLMLAITMATIFTVNSTLPIYAAVDKNNATAAVQNESKRYTV view full sequnce in fasta |
Functional Classification | Ic |
Molecular Weight | 112023.2 |
Chemical Formula | C5028H7666N1300O1564S21 |
Isoelectric Point | 5.58 |
Hydrophobicity | -0.714 |
Melting Point (℃) | N.A. |
Half Life | N.A. |
Description | This enzyme is derived from fermentation of Clostridium histolyticum |
Indication/Disease | It promotes debridement of necrotic tissue and helps in the treatment of severe burns and dermal ulcers including decubitus ulcers. |
Pharmacodynamics | Helps in the treatment of skin ulcers and severe burns, collagenase is able to digest collagen in necrotic tissue at physiological pH by hydrolyzing the peptide bonds of undenatured and denatured collagen. Collagenase thus contributes towards the formation of granulation tissue and subsequent epithelization of dermal ulcers and severely burned areas. The action of collagenase may remove substrates necessary for bacterial proliferation or may permit antibodies, leukocytes, and antibiotics better access to the infected area. |
Mechanism of Action | Collagenase is a protease that is specific to collagen. The triple helical region of interstitial collagens is highly resistant to most cell proteinases. However, during remodeling of the connective tissue in such processes as wound healing and metastasis, collagen becomes susceptible to cleavage by collagenases. Collagenase cleaves all 3 alpha helical chains of native Types I, II and III collagens at a single locus by hydrolyzing the peptide bond following the Gly residue of the sequence: Gly 775-(Ile or Leu) 776-(Ala or Leu) 777 located approximately three-fourths of the chain length from each N-terminus. |
Toxicity | N.A. |
Metabolism | N.A. |
Absorption | N.A. |
Volume of Distribution | N.A. |
Clearance | N.A. |
Categories | N.A. |
Patents Number | N.A. |
Date of Issue | N.A. |
Date of Expiry | N.A. |
Drug Interaction | Grafco Silver Nitrate (silver nitrate topical) |
Target | N.A. |
Information of corresponding available drug in the market | |
Brand Name | Santyl |
Company | Advance Biofactures Corp |
Brand Discription | Collagenase Santyl ointment is a sterile enzymatic debriding ointment which contains 250 collagenase units per gram of white petrolatum USP. The enzyme collagenase is derived from the fermentation by Clostridium histolyticum. It possesses the unique abili |
Prescribed for | Used to remove dead skin from wounds and burned areas. Santyl ointment is an enzymatic debriding ointment which works by breaking down dead skin. |
Chemical Name | N.A. |
Formulation | Collagenase Santyl Ointment contains 250 units of collagenase enzyme per gram of white petrolatum USP. The potency assay of collagenase is based on the digestion of undenatured collagen (from bovine Achilles tendon) at pH 7.2 and 37°C for 24 hours. The nu |
Physcial Appearnce | Sterile enzymatic debriding ointment |
Route of Administration | Apply on the affected area. |
Recommended Dosage | Collagenase Santyl Ointment should be applied once daily (or more frequently if the dressing becomes soiled as from incontinence). |
Contraindication | Hypersensitivity |
Side Effects | Rash; hives; itching; difficulty breathing; tightness in the chest; swelling of the mouth, face, lips, or tongue; signs of infection (eg, fever, chills, or persistent sore throat). |
Useful Link | http://www.santyl.com |
PubMed ID | 11937475 |
3-D Structure | Th1042 (View) or (Download) |