A database of FDA approved therapeutic peptides and proteins
| This page displays user query in tabular form. |
1306 details |
| Primary information | |
|---|---|
| ThPP ID | Th1043 |
| Therapeutic Peptide/Protein Name | Rasburicase |
| Sequence | SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 34109.5 |
| Chemical Formula | C1521H2381N417O461S7 |
| Isoelectric Point | 7.16 |
| Hydrophobicity | -0.465 |
| Melting Point (℃) | N.A. |
| Half Life | 18 hours |
| Description | Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus. |
| Indication/Disease | For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy). |
| Pharmacodynamics | Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis. |
| Mechanism of Action | Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin). |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | 75.8 to 138 mL/kg [adult patients] |
| Clearance | N.A. |
| Categories | Antihyperuricemic Agents |
| Patents Number | CA2148537 |
| Date of Issue | 16/07/02 |
| Date of Expiry | 03/05/15 |
| Drug Interaction | Citanest Forte (epinephrine / prilocaine) |
| Target | N.A. |
| Information of corresponding available drug in the market | |
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearnce | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | Individulas deficient in glucose -6-phosphate dehydrogenase. |
| Side Effects | N.A. |
| Useful Link | http://www.drugs.com/cdi/elitek.html |
| PubMed ID | 20445229, 20394650 |
| 3-D Structure | Th1043 (View) or (Download) |