A database of FDA approved therapeutic peptides and proteins
| This page displays user query in tabular form. |
1316 details |
| Primary information | |
|---|---|
| ThPP ID | Th1044 |
| Therapeutic Peptide/Protein Name | Adalimumab |
| Sequence | Light-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 144190.3 |
| Chemical Formula | C6428H9912N1694O1987S46 |
| Isoelectric Point | 8.25 |
| Hydrophobicity | -0.441 |
| Melting Point (℃) | N.A. |
| Half Life | 240-480 hours |
| Description | Adalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system. |
| Indication/Disease | For treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease. |
| Pharmacodynamics | Used in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction. |
| Mechanism of Action | Adalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement. |
| Toxicity | N.A. |
| Metabolism | Most likely removed by opsonization via the reticuloendothelial system. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 12 mL/hr [RA patients with dose 0.25-10 mg/kg] |
| Categories | Antirheumatic Agents |
| Patents Number | CA2243459 |
| Date of Issue | 17/09/02 |
| Date of Expiry | 10/02/17 |
| Drug Interaction | Canakinumab and Rilonacept increase immunosuppressive effects and risk of infection. |
| Target | Tumor necrosis factor,Low affinity immunoglobulin gamma Fc region receptor III-B,Complement C1r subcomponent,Complement C1q subcomponent subunit A,Complement C1q subcomponent subunit B,Complement C1q subcomponent subunit C,Low affinity immunoglobulin gamm |
| Information of corresponding available drug in the market | |
| Brand Name | Humira |
| Company | Abbott Laboratories |
| Brand Discription | HUMIRA is a recombinant human IgG1 monoclonal antibody specific for human tumor necrosis factor. HUMIRA was created using phage display technology resulting in an antibody with human derived heavy and light chain variable regions and human IgG1:k constant |
| Prescribed for | Humira is used to treat rheumatoid arthritis, juvenile idiopathic arthritis, psoriatic arthritis, ankylosing spondylitis, and plaque psoriasis. It is also used to treat Crohn's disease or ulcerative colitis, after other drugs have been tried without succe |
| Chemical Name | N.A. |
| Formulation | It is supplied for a single use. Each prefilled syringe delivers 0.8 mL (40 mg) of drug product. Each 0.8 mL of HUMIRA contains 40 mg adalimumab, 4.93 mg sodium chloride, 0.69 mg monobasic sodium phosphate dihydrate, 1.22 mg dibasic sodium phosphate dihyd |
| Physcial Appearnce | Sterile, preservative-free solution |
| Route of Administration | Subcutaneous administration |
| Recommended Dosage | The recommended dose of HUMIRA for adult patients with rheumatoid arthritis (RA), psoriatic arthritis (PsA), or ankylosing spondylitis (AS) is 40 mg administered every other week. Methotrexate (MTX), other non-biologic DMARDS, glucocorticoids, nonsteroidal anti-inflammatory drugs (NSAIDs), and/or analgesics may be continued during treatment with HUMIRA. |
| Contraindication | Hypersensitivity |
| Side Effects | Fever, chills, sore throat, vomiting, diarrhea, flu symptoms, pain or burning when you urinate; signs of tuberculosis - fever with ongoing cough, weight loss (fat or muscle); pale skin, easy bruising or bleeding (nosebleeds, bleeding gums); numbness. |
| Useful Link | PDB sequence Link:http://www.rcsb.org/pdb/download/downloadFile.do?fileFormat=FASTA;compression=NO;structureId=1IGT |
| PubMed ID | 25629655, 23620660 |
| 3-D Structure | Th1044 (View) or (Download) |