Detailed description page of THPdb

This page displays user query in tabular form.

1361 details

Primary information
ThPP ID	Th1051
Therapeutic Peptide/Protein Name	Human Serum Albumin
Sequence	MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIA view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	66472.2
Chemical Formula	C2936H4624N786O889S41
Isoelectric Point	5.67
Hydrophobicity	-0.395
Melting Point (℃)	62
Half Life	N.A.
Description	Human serum albumin isolated from expired blood plasma.
Indication/Disease	Human Serum Albumin is indicated for treatment of severe blood loss, hypervolemia, hypoproteinemia.
Pharmacodynamics	Human Serum Albumin regulates the colloidal osmotic pressure of blood. It is used to increase the circulating plasma volume, thereby reducing hemoconcentrtion and blood viscosity. Also used as a transport protein that binds naturally occurring, therapeutic and toxic materials in circulation.
Mechanism of Action	Human Serum albumin acts as a high molecular weight, very soluble osmolyte.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Serum substitutes
Patents Number	US6723303
Date of Issue	21/04/05
Date of Expiry	21/04/25
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Albuminar
Company	CSL Behring
Brand Discription	AlbuminarÂ is a sterile aqueous solution of albumin obtained from large pools of adult human venousÂ plasmaby low temperature controlled fractionation according to the Cohn process. It is stabilized with 0.02 MÂ sodiumÂ acetyltryptophanate and 0.02 M sodium caprylate and pasteurized at 60 for 10 hours.
Prescribed for	precscribed in treatment of Shock, Burns, Hypoproteinemia with or without edema
Chemical Name	N.A.
Formulation	Albumin (Human) 25% (albumin human) is a solution containing in each 100 mL, 25 grams of serum albumin, osmotically equivalent to 500 mL of normal human plasma. The pH of the solution is adjusted with sodium bicarbonate, sodium hydroxide, or acetic acid. Approximate concentrations of significant electrolytes per liter are: sodium - 130-160 mEq; and potassium - n.m.t. 1 mEq.
Physcial Appearnce	Albumin (Human) 25%, is a Sterile aqueous solution of albumin obtained from large pools of adult human venous plasma by low temperature controlled fractionation according to the Cohn process.
Route of Administration	Albumin (Human) 25%, Albuminar-25 (albumin human)
Recommended Dosage	Albumin (Human) 25%, Albuminar-25 (albumin (human)) may be given intravenously without dilution or it may be diluted with normal saline or 5% dextrose before administration. 200 mL per liter gives a solution which is approximately isotonic and iso-osmotic with citrated plasma.
Contraindication	Albumin (Human) 25% may be contraindicated in patients with severe anemia or cardiac failure and in patients with a history of allergic reactions to human albumin.
Side Effects	Allergic or pyrogenic reactions are characterized primarily by fever and chills; rash, nausea, vomiting, tachycardia and hypotension have also been reported. if administered rapidly, may result in vascular overload with resultant pulmonary edema.
Useful Link	http://www.rxlist.com/albuminar-drug.htm
PubMed ID	12846933, 9675210
3-D Structure	Th1051 (View) or (Download)