Detailed description page of THPdb

This page displays user query in tabular form.

1362 details

Primary information
ThPP ID	Th1051
Therapeutic Peptide/Protein Name	Human Serum Albumin
Sequence	MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIA view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	66472.2
Chemical Formula	C2936H4624N786O889S41
Isoelectric Point	5.67
Hydrophobicity	-0.395
Melting Point (℃)	62
Half Life	N.A.
Description	Human serum albumin isolated from expired blood plasma.
Indication/Disease	Human Serum Albumin is indicated for treatment of severe blood loss, hypervolemia, hypoproteinemia.
Pharmacodynamics	Human Serum Albumin regulates the colloidal osmotic pressure of blood. It is used to increase the circulating plasma volume, thereby reducing hemoconcentrtion and blood viscosity. Also used as a transport protein that binds naturally occurring, therapeutic and toxic materials in circulation.
Mechanism of Action	Human Serum albumin acts as a high molecular weight, very soluble osmolyte.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Serum substitutes
Patents Number	US5558094
Date of Issue	01/03/99
Date of Expiry	29/02/16
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Albutein
Company	GRIFOLS
Brand Discription	Albutein is a concentrate of plasma proteins from human blood. It works by increasing plasma volume or serum albumin levels.
Prescribed for	For treatment of hypovolemic shock,As an adjunct in hemodialysis for patients undergoing long-term dialysis or for those patients who are fluid-overloaded and cannot tolerate substantial volumes of salt solution for therapy of shock or hypotension
Chemical Name	N.A.
Formulation	AlbuteinÂ 20% is clinically desirable, compatible diluents include sterile 0.9% Sodium Chloride solution or sterile 5% Dextrose in Water.
Physcial Appearnce	AlbuteinÂ 20% is a Sterile, aqueous solution for single dose intravenous administration containing 20% human albumin (weight/volume).
Route of Administration	Albutein 20% is to be administered by the Intraven
Recommended Dosage	AlbuteinÂ 20% is administered intravenously. The total dosage will vary with the individual. In adults, an initial infusion of 100 mL is suggested.Â
Contraindication	AlbuteinÂ 20% is contraindicated in patients with severe anemia or cardiac failure in the presence of normal or increased intravascular volume.
Side Effects	The most common adverse reactions include fever and chills, rash, nausea, vomiting, tachycardia and hypotension. Should an adverse reaction occur, slow or stop the infusion for a short period of time which may result in the disappearance of the symptoms. If administration has been stopped and the patient requires additional AlbuteinÂ 20%, material from a different lot should be used.
Useful Link	Peters, T., Jr., Serum Albumin in:Â The Plasma Proteins, 2nd Ed., Putnam F.W. (ed), New York, Academic Press, 1:133-181, 1975. Finlayson, J.S., Albumin Products Semin Thromb Hemo, 6:85-120, 1980.
PubMed ID	12846933, 9675210
3-D Structure	Th1051 (View) or (Download)