A database of FDA approved therapeutic peptides and proteins
| This page displays user query in tabular form. |
1366 details |
| Primary information | |
|---|---|
| ThPP ID | Th1053 |
| Therapeutic Peptide/Protein Name | Serum albumin iodonated |
| Sequence | MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIA view full sequnce in fasta |
| Functional Classification | IV |
| Molecular Weight | 66472.2 |
| Chemical Formula | C2936H4624N786O889S41 |
| Isoelectric Point | 5.67 |
| Hydrophobicity | -0.395 |
| Melting Point (℃) | 62 |
| Half Life | N.A. |
| Description | A diagnostic radiopharmaceutical containing iodinated I 131 albumin for intravenous imaging. Following Intravenous infusion, radioiodinated albumin human is uniformly distributed throughout the intravascular pool within 10 minutes; extravascular distribution takes place more slowly (2 days). Indicated for use in determinations of total blood and plasma volumes, cardiac output, cardiac and pulmonary blood volumes and circulation times |
| Indication/Disease | For determination of total blood and plasma volumes |
| Pharmacodynamics | Regulates the colloidal osmotic pressure of blood. It is used to increase the circulating plasma volume, thereby reducing hemoconcentrtion and blood viscosity. Also used as a transport protein that binds naturally occurring, therapeutic and toxic materials in circulation. |
| Mechanism of Action | Serum albumin acts as a high molecular weight, very soluble osmolyte |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Diagnostic Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | Rilonacept results in increased immunosuppressive effects; increases the risk of infection |
| Target | N.A. |
| Information of corresponding available drug in the market | |
| Brand Name | Jeanotope |
| Company | IsoTex Diagnostics |
| Brand Discription | Jeanotope I-125 was prepared from the blood that was non-reactive when tested for hepatitis B surface antigen (HBsAg) and HIV antibody. |
| Prescribed for | Jeanotope I-125 is indicated for use in the determination of total blood and plasma volume. |
| Chemical Name | N.A. |
| Formulation | Each milliliter provides approximately 10 mg protein (normal human serum albumin), 1.6 mg sodium phosphate, 16 mg sodium biphosphate, not more than 0.4 mg guanidine hydrochloride, sodium chloride for isotonicity, and 9 mg benzyl alcohol as a preservative. The stabilizer aceryltryptophanate and sodium caprylate have a concentration of less, than 0.0089M. |
| Physcial Appearnce | Jeanatope 1-125 (Iodinated 1-125 Albumin Injection) is a Sterile, nonpyrogenic, aqueos solution |
| Route of Administration | Intravenous infusion |
| Recommended Dosage | When a procedure such as a blood volume determination is to be repeated, the total dosage administered in any one week should not exceed 7.4 megabecquerels, (200 microcuries). |
| Contraindication | At present there are no known contraindications to the use of this preparation |
| Side Effects | Although the immunological properties of albumin human are believed to be virtually unaltered by the iodination process, there is a theoretical possibility that allergic reactions may occur in patients receiving additional doses a number of weeks after an initial dose. |
| Useful Link | http://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=7b6f6a5e-f456-4db9-a3da-44d870ee6547 |
| PubMed ID | 17139284, 17016424 |
| 3-D Structure | Th1053 (View) or (Download) |