A database of FDA approved therapeutic peptides and proteins
| This page displays user query in tabular form. |
1379 details |
| Primary information | |
|---|---|
| ThPP ID | Th1058 |
| Therapeutic Peptide/Protein Name | Interferon alfacon-1 |
| Sequence | CDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKA view full sequnce in fasta |
| Functional Classification | Ib |
| Molecular Weight | 19271 |
| Chemical Formula | C860H1353N229O255S9 |
| Isoelectric Point | 5.99 |
| Hydrophobicity | 0.339 |
| Melting Point (℃) | 61 |
| Half Life | The elimination half-life following both intramuscular and subcutaneous injections was approximately |
| Description | Recombinant type-I Interferon alpha 2b (human leukocyte clone hif-sn 206 protein moiety reduced), composed of 165 amino acid residues with R at position 23. It resembles leukocyte secreted interferon. Widely used as an antiviral or antineoplastic agent. |
| Indication/Disease | For the treatment of hairy cell leukemia, malignant melanoma, and AIDS-related Kaposi's sarcoma. |
| Pharmacodynamics | Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R. |
| Mechanism of Action | Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which upon dimerization activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta. |
| Toxicity | There is limited experience with overdosage. Postmarketing surveillance includes reports of patients receiving a single dose as great as 10 times the recommended dose. In general, the primary effects of an overdose are consistent with the effects seen with therapeutic doses of interferon alfa-2b. Hepatic enzyme abnormalities, renal failure, hemorrhage, and myocardial infarction have been reported with single administration overdoses and/or with longer durations of treatment than prescribed. Toxic effects after ingestion of interferon alfa-2b are not expected because interferons are poorly absorbed orally. |
| Metabolism | N.A. |
| Absorption | Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Antiviral Agents and Immunosuppressive Agents |
| Patents Number | CA1341567 |
| Date of Issue | 20/02/12 |
| Date of Expiry | 20/02/29 |
| Drug Interaction | Zidovudine, The interferon increases the effect and toxicity of zidovudine |
| Target | Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2 |
| Information of corresponding available drug in the market | |
| Brand Name | INFERGEN |
| Company | Kadmon Pharmaceuticals, LLC. |
| Brand Discription | Interferon alfacon-1 is a wholly synthetic type-I interferon. The 166-amino acid sequence of interferon alfacon-1 was derived by scanning the sequences of several natural interferon alpha subtypes and assigning the most frequently observed amino acid in each corresponding position resulting in a consensus sequence. |
| Prescribed for | INFERGEN (interferon alfacon-1) is indicated for treatment of chronic hepatitis C in patients 18 years of age or older with compensated liver disease. |
| Chemical Name | N.A. |
| Formulation | single-use vials containing 9 mcg and 15 mcg interferon alfacon-1 at a fill volume of 0.3 mL and 0.5 mL, respectively. INFERGEN vials contain 0.03 mg/mL interferon alfacon-1, sodium chloride (5.9 mg/mL), and sodium phosphate (3.8 mg/mL) in Water for Injection, USP. |
| Physcial Appearnce | INFERGEN is a Sterile, clear, colorless, preservative-free liquid |
| Route of Administration | Subcutaneous Injection |
| Recommended Dosage | The recommended dose of INFERGEN monotherapy for the initial treatment of chronic HCV infection is 9 mcg administered three times a week as a single subcutaneous injection for 24 weeks. |
| Contraindication | contraindicated in patients with hepatic decompensation; autoimmune hepatitis; known hypersensitivity reactions such as urticaria, angioedema, bronchoconstriction, anaphylaxis to interferon alphas or to any component of the product. |
| Side Effects | INFERGEN alone or in combination with ribavirin causes a broad range of serious adverse reactions; |
| Useful Link | http://www.rxlist.com/infergen-drug.htm http://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=29ad47ed-cb94-470b-b3ab-9281abf414d5 |
| PubMed ID | 19714721, 19291790, 17235418, 16758306, 16179960, 16179960, 16179960, 19714721, 19291790 |
| 3-D Structure | Th1058 (View) or (Download) |