A database of FDA approved therapeutic peptides and proteins
This page displays user query in tabular form. |
1389 details |
Primary information | |
---|---|
ThPP ID | Th1062 |
Therapeutic Peptide/Protein Name | Rituximab |
Sequence | Heavy Chain: QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWV view full sequnce in fasta |
Functional Classification | IIa |
Molecular Weight | 143859.7 |
Chemical Formula | C6416H9874N1688O1987S44 |
Isoelectric Point | 8.68 |
Hydrophobicity | -0.414 |
Melting Point (℃) | 61 (FAB f |
Half Life | 0.8 hours (mammalian reticulocytes, in vitro) |
Description | Rituxan is a genetically engineered chimeric murine/human monoclonal antibody directed against the CD20 antigen found on the surface of normal and malignant B lymphocytes. The antibody is an IgG1 kappa immunoglobulin containing murine light- and heavy-chain variable region sequences and human constant region sequences. Rituximab is composed of two heavy chains of 451 amino acids and two light chains of 213 amino acids. |
Indication/Disease | For treatment of CD20-positive non-Hodgkins lymphoma, chronic lymphocytic leukemia, and rheumatoid arthritis. |
Pharmacodynamics | Rituximab binds to the CD20 antigen, which is predominantly expressed on mature B cells and 90% of B-cell non-Hodgkin's lympohomas. The antibody leads to selective killing of B-cells. |
Mechanism of Action | The Fab regions of rituximab binds to the CD20 antigen on B lymphocytes, while the Fc domain recruits antibodies and complements to mediate cell lysis. |
Toxicity | N.A. |
Metabolism | Most likely removed by opsonization via the reticuloendothelial system. |
Absorption | N.A. |
Volume of Distribution | 3.1 L |
Clearance | 0.34 L/day [RA patients] |
Categories | Antineoplastic Agents, Immunologic Factors and Antirheumatic Agents |
Patents Number | CA2149329 |
Date of Issue | 16/07/12 |
Date of Expiry | 13/11/17 |
Drug Interaction | Azilsartan medoxomil used in combination with rituximab may lead to hypotension |
Target | N.A. |
Information of corresponding available drug in the market | |
Brand Name | Rituxan |
Company | Biogen Idec Inc., and Genentech USA, Inc |
Brand Discription | Rituxan (rituximab) is a genetically engineered chimeric murine/humanmonoclonal IgG1 kappa antibody directed against the CD20 antigen. Rituximab has an approximate molecular weight of 145 kD. Rituximab has a binding affinity for the CD20 antigen of approximately 8.0 nM. Rituximab is produced by mammalian cell (Chinese Hamster Ovary) suspension culture in a nutrient medium containing the antibiotic gentamicin. Gentamicin is not detectable in the final product. |
Prescribed for | used in Non–Hodgkin's Lymphoma (NHL), Chronic Lymphocytic Leukemia (CLL), Rheumatoid Arthritis (RA), Granulomatosis with Polyangiitis (GPA) (Wegener's Granulomatosis) and Microscopic Polyangiitis (MPA) |
Chemical Name | N.A. |
Formulation | Rituxan is supplied at a concentration of 10 mg/mL in either 100 mg/10 mL or 500 mg/50 mL single-use vials. The product is formulated in polysorbate 80 (0.7 mg/mL), sodium citrate dihydrate (7.35 mg/mL), sodium chloride (9 mg/mL) and Water for Injection. The pH is 6.5. |
Physcial Appearnce | Rituxan is a Sterile, clear, colorless, preservative-free liquid concentrate |
Route of Administration | Â Intravenous administration |
Recommended Dosage | Initiate infusion at a rate of 50 mg/hr. In the absence of infusion toxicity, increase infusion rate by 50 mg/hr increments every 30 minutes, to a maximum of 400 mg/hr. In NHL the recommended dose is 375 mg/m2 as an Intravenous infusion. In CLL 375 mg/m2 the day prior to the initiation of FC chemotherapy, then 500 mg/m2 on Day 1 of cycles 2–6 (every 28 days). Administer Rituxan as two-1000 mg Intravenous infusions separated by 2 weeks. Administer Rituxan as a 375 mg/m2 Intravenous infusion once weekly for 4 weeks. |
Contraindication | none |
Side Effects | Infusion reactions, Mucocutaneous reactions, Hepatitis B reactivation with fulminant hepatitis, Progressive multifocal leukoencephalopathy , Tumor lysis syndrome , Infections, Cardiac arrhythmias, Renal toxicity, Bowel obstruction and perforation |
Useful Link | http://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=b172773b-3905-4a1c-ad95-bab4b6126563 http://www.rxlist.com/rituxan-drug.htm |
PubMed ID | 21813259, 16705086, 15795920, 15201414, 12826649, 9704735, 25609919, 25573987, 25586272 |
3-D Structure | Th1062 (View) or (Download) |