A database of FDA approved therapeutic peptides and proteins
This page displays user query in tabular form. |
1434 details |
Primary information | |
---|---|
ThPP ID | Th1074 |
Therapeutic Peptide/Protein Name | Alglucerase |
Sequence | ARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRRME view full sequnce in fasta |
Functional Classification | Ia |
Molecular Weight | 55597.4 |
Chemical Formula | C2532H3854N672O711S16 |
Isoelectric Point | 7.41 |
Hydrophobicity | -0.168 |
Melting Point (℃) | N.A. |
Half Life | 3.6-10.4 min |
Description | Human Beta-glucocerebrosidase or Beta-D-glucosyl-N-acylsphingosine glucohydrolase E.C. 3.2.1.45. 497 residue protein with N-linked carbohydrates. Alglucerase is prepared by modification of the oligosaccharide chains of human Beta-glucocerebrosidase. The modification alters the sugar residues at the non-reducing ends of the oligosaccharide chains of the glycoprotein so that they are predominantly terminated with mannose residues |
Indication/Disease | For the treatment of Gaucher's disease (deficiency in glucocerebrosidase) |
Pharmacodynamics | Gaucher disease is characterized by a functional deficiency in Beta-glucocerebrosidase enzymatic activity and the resultant accumulation of lipid glucocerebroside in tissue macrophages which become engorged and are termed Gaucher cells. Gaucher cells are typically found in liver, spleen and bone marrow. This can lead to an enlarged spleen and liver (hepatosplenomegaly). Secondary hematologic sequelae include severe anemia and thrombocytopenia. Injections of alglucerase into Gaucher disease patients leads to elevated serum levels of the enzyme and reduction in the accumulation of glucocerebroside |
Mechanism of Action | Alglucerase catalyzes the hydrolysis of the glycolipid, glucocerebroside, to glucose and ceramide as part of the normal degradation pathway for membrane lipids. |
Toxicity | N.A. |
Metabolism | N.A. |
Absorption | N.A. |
Volume of Distribution | 49.4 to 282.1 mL/kg |
Clearance | N.A. |
Categories | Enzyme Replacement Agents |
Patents Number | N.A. |
Date of Issue | N.A. |
Date of Expiry | N.A. |
Drug Interaction | N.A. |
Target | N.A. |
Information of corresponding available drug in the market | |
Brand Name | N.A. |
Company | N.A. |
Brand Discription | N.A. |
Prescribed for | N.A. |
Chemical Name | N.A. |
Formulation | N.A. |
Physcial Appearnce | N.A. |
Route of Administration | N.A. |
Recommended Dosage | N.A. |
Contraindication | N.A. |
Side Effects | N.A. |
Useful Link | N.A. |
PubMed ID | 19265748 |
3-D Structure | Th1074 (View) or (Download) |