A database of FDA approved therapeutic peptides and proteins
| This page displays user query in tabular form. |
1437 details |
| Primary information | |
|---|---|
| ThPP ID | Th1076 |
| Therapeutic Peptide/Protein Name | Laronidase |
| Sequence | APHLVQVDAARALWPLRRFWRSTGFCPPLPHSQADQYVLSWDQQLNLAYV view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 69899.4 |
| Chemical Formula | C3160H4848N898O881S12 |
| Isoelectric Point | 9.09 |
| Hydrophobicity | -0.3 |
| Melting Point (℃) | N.A. |
| Half Life | 1.5-3.6 hrs |
| Description | Human recombinant alpha-L-iduronidase, produced by recombinant DNAtechnology in a Chinese hamster ovary cell line. Laronidase is a glycoprotein with a predicted amino acid sequence of the recombinant form, as well as the nucleotide sequence that encodes it, are identical to a polymorphic form of human a-L-iduronidase. It contains 6 N-linked oligosaccharide modification sites. |
| Indication/Disease | For the treatment of mucopolysaccharidosis |
| Pharmacodynamics | Laronidase is used to treat mucopolysaccharide storage disorders (Hurlers syndrome) caused by deficiencies of alpha-L-iduronidase. Reduced or absent a-L-iduronidase activity results in the accumulation of the GAG substrates, dermatan sulfate and heparan sulfate, throughout the body and leads to widespread cellular, tissue, and organ dysfunction. |
| Mechanism of Action | Laronidase catalyses the hydrolysis of terminal alpha-L-iduronic acid residues of dermatan sulfate and heparin sulfate. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Enzyme Replacement Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market | |
| Brand Name | ALDURAZYME |
| Company | Genzyme Corporation |
| Brand Discription | ALDURAZYME (laronidase) is a polymorphic variant of the human enzyme α-L-iduronidase that is produced by recombinant DNA technology in a Chinese hamster ovary cell line. α-L-iduronidase (glycosaminoglycan α- L-iduronohydrolase, EC 3.2.1.76) is a lysosomal hydrolase that catalyzes the hydrolysis of terminal α-Liduronic acid residues of dermatan sulfate and heparan sulfate. |
| Prescribed for | ALDURAZYME is a hydrolytic lysosomal glycosaminoglycan (GAG)-specific enzyme indicated for patients with Hurler and Hurler-Scheie forms of Mucopolysaccharidosis I (MPS I) and for patients with the Scheie form who have moderate to severe symptoms. The risks and benefits of treating mildly affected patients with the Scheie form have not been established. ALDURAZYME has been shown to improve pulmonary function and walking capacity. ALDURAZYME has not been evaluated for effects on the central nervous system manifestations of the disorder |
| Chemical Name | N.A. |
| Formulation | The solution in each vial contains a nominal laronidase concentration of 0.58 mg/mL and a pH of approximately 5.5. The extractable volume of 5.0 mL from each vial provides 2.9 mg laronidase, 43.9 mg sodium chloride, 63.5 mg sodium phosphate monobasic monohydrate, 10.7 mg sodium phosphate dibasic heptahydrate, and 0.05 mg polysorbate 80. ALDURAZYME does not contain preservatives; vials are for single use only. |
| Physcial Appearnce | ALDURAZYME, for IV infusion, is supplied as a sterile, nonpyrogenic, colorless to pale yellow, clear to slightly opalescent solution that must be diluted prior to administration in 0.9% Sodium Chloride Injection |
| Route of Administration | Intravenous (Intravenous) infusion |
| Recommended Dosage | 0.58 mg/kg of body weight administered once weekly |
| Contraindication | None |
| Side Effects | The most commonly reported infusion reactions occurring in at least 10% of patients 6 months of age and older were pyrexia, chills, blood pressure increased, tachycardia, and oxygen saturation decreased (6). The most frequently occurring adverse reactions occurring in at least 10% of patients 6 years and older are rash, upper respiratory tract infection, injection site reaction, hyperreflexia, paresthesia, flushing, and poor venous access. |
| Useful Link | http://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=a80ac249-cae4-41f3-88bb-344088b20e60 http://www.rxlist.com/aldurazyme-drug.htm |
| PubMed ID | 19117887, 18251718 |
| 3-D Structure | Th1076 (View) or (Download) |