A database of FDA approved therapeutic peptides and proteins
| This page displays user query in tabular form. |
1466 details |
| Primary information | |
|---|---|
| ThPP ID | Th1090 |
| Therapeutic Peptide/Protein Name | Daclizumab |
| Sequence | QVQLVQSGAEVKKPGSSVKVSCKASGYTFTSYRMHWVRQAPGQGLEWIGY view full sequnce in fasta |
| Functional Classification | Iia |
| Molecular Weight | 142612.1 |
| Chemical Formula | C6332H9808N1678O1989S42 |
| Isoelectric Point | 8.46 |
| Hydrophobicity | -0.437 |
| Melting Point (℃) | 61 (FAB fr |
| Half Life | 11-38 days |
| Description | Humanized, recombinant, monoclonal antibody (IgG1k) directed agaisnt the epitope in the A antigenic site of the F protein of respiratory syncytial virus (RSV). Synagis is a composite of human (95%) and murine (5%) antibody sequences. The human heavy chain sequence is derived from the constant domains of human IgG1 and the variable framework regions of the VH genes Cor (1) and Cess (2). The human light chain sequence is derived from the constant domain of Ck and the variable framework regions of the VL gene K104 withJk-4. Palivizumab is expressed from a stable murine myeloma cell line (NS0). Palivizumab is composed of to heavy chains (50.6 kDa each) and two light chains (27.6 kDa each), contains 1-2% carbohydrate by weight and has a molecular weight of 147.7 kDa ± 1 kDa (MALDI-TOF). |
| Indication/Disease | Zenapax is a humanized monoclonal antibody used for prevention of renal transplant rejection |
| Pharmacodynamics | Zenapax functions as an IL-2 receptor antagonist. Specifically it inhibits IL-2-mediated activation of lymphocytes, a critical pathway in the cellular immune response involved in allograft rejection. |
| Mechanism of Action | Zenepax binds with high-affinity to the Tac subunit of the high-affinity IL-2 receptor complex and inhibits IL-2 binding. The IL-2 receptor (Tac) subunit is expressed on activated but not resting lymphocytes. |
| Toxicity | N.A. |
| Metabolism | Most likely removed by opsonization via the reticuloendothelial system when bound to lymphocytes. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Immunosuppressive Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market | |
| Brand Name | Zenapax |
| Company | Roche |
| Brand Discription | ZENAPAX (daclizumab) is an immunosuppressive, humanized IgG1 monoclonal antibody produced by recombinant DNA technology that binds specifically to the alpha subunit (p55 alpha, CD25, or Tac subunit) of the human high-affinity interleukin-2 (IL-2) receptor that is expressed on the surface of activated lymphocytes. The molecular weight predicted from the DNA sequence is 144 kilodaltons. |
| Prescribed for | is indicated for the prophylaxis of acute organ rejection in patients receiving renal transplants. It is used as part of an immunosuppressive regimen that includes cyclosporine and corticosteroids. The efficacy of ZENAPAX (daclizumab) for the prophylaxis of acute rejection in recipients of other solid organ allografts has not been demonstrated. |
| Chemical Name | N.A. |
| Formulation | Each milliliter of ZENAPAX contains 5 mg of daclizumab and 3.6 mg sodium phosphate monobasic monohydrate, 11 mg sodium phosphate dibasic heptahydrate, 4.6 mg sodium chloride, 0.2 mg polysorbate 80, and may contain hydrochloric acid or sodium hydroxide to adjust the pH to 6.9. No preservatives are added. |
| Physcial Appearnce | Clear, sterile, colorless concentrate for further dilution and intravenous administration |
| Route of Administration | Intravenous |
| Recommended Dosage | ZENAPAX (daclizumab) is used as part of an immunosuppressive regimen that includes cyclosporine and corticosteroids. The recommended dose for ZENAPAX (daclizumab) in adult and pediatric patients is 1.0 mg/kg. The calculated volume of ZENAPAX (daclizumab) should be mixed with 50 mL of sterile 0.9% sodium chloride solution and administered via a peripheral or central vein over a 15-minute period. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | http://www.rxlist.com/zenapax-drug.htm http://www.drugs.com/mtm/daclizumab.html |
| PubMed ID | 25093077, 25635261, 25501951, 25267440, 25212703, 25093077, 25051810, 24897146 |
| 3-D Structure | Th1090 (View) or (Download) |