A database of FDA approved therapeutic peptides and proteins
| This page displays user query in tabular form. |
1621 details |
| Primary information | |
|---|---|
| ThPP ID | Th1134 |
| Therapeutic Peptide/Protein Name | Asparaginase erwinia chrysanthemi |
| Sequence | ADKLPNIVILATGGTIAGSAATGTQTTGYKAGALGVDTLINAVPEVKKLA view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 140000 |
| Chemical Formula | C1546H2510N432O476S9 |
| Isoelectric Point | N.A. |
| Hydrophobicity | N.A. |
| Melting Point (℃) | N.A. |
| Half Life | Elimination half life- 16 hrs |
| Description | Erwinaze (asparaginase from Erwiniachryanthemi) is an asparaginase specific enzyme derived from Erwiniachrysanthemi. L-asparaginase is a homo-tetramer with each subnuit having a molecular weight of about 35 kDa. It is an antineoplastic agent and was FDA approved in November 19, 2011. |
| Indication/Disease | Asparaginase Erwinia chryanthemi is for the treatment of patients with acute lymphoblastic leukemia (ALL) that have developed a hypersensitivity to Escherichia coli-derivied asparaginase. It is a component of a multi-agent chemotherpeutic regimen for the treatment of the aforementioned disease and is considered second- or third- line treatment in European and American protocols. |
| Pharmacodynamics | N.A. |
| Mechanism of Action | Asparaginase Erwinia chrysanthemi catalyzes the deamidation of asparagine to aspartic acid and ammonia, resulting in a reduction in circulating levels of asparagine in the plasma. The mechanism of action of Erwinaze is thought to be based on the inability of leukemic cells to synthesize asparagine due to lack of asparagine synthetase activity, resulting in cytotoxicity specific for leukemic cells that depend on an exogenous source of the amino acid asparagine for their protein metabolism and survival. |
| Toxicity | Because Erwinaze is injected intramuscularly, there is a higher chance of experiencing major skin reactions. Although the perceived benefit of Erwinia chryanthemi-derivied asparaginase is a lower incidence of hypersensitivity, there is still a chance that one may experience symptoms such as, but not limited to, anaphylaxis, pain, edema. Pancreatitis may also occur during the first few weeks of treatment with asparaginase. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Enzymes |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market | |
| Brand Name | Erwinaze |
| Company | EUSA Pharma |
| Brand Discription | ERWINAZE (asparaginase Erwinia chrysanthemi) contains an asparagine specific enzyme derived from Erwinia chrysanthemi. L-asparaginase is a tetrameric enzyme consisting of four identical subunits, each having a molecular weight of about 35 kDa. The activity of ERWINAZE is expressed in terms of International Units. |
| Prescribed for | acute lymphoblastic leukemia |
| Chemical Name | N.A. |
| Formulation | Each vial contains 10,000 International Units of asparaginase Erwinia chrysanthemi, and the following inactive ingredients: glucose monohydrate (5.0 mg), sodium chloride (0.5 mg). |
| Physcial Appearnce | ERWINAZE is supplied as a Sterile, lyophilized, white powder in vials. |
| Route of Administration | Intramuscular |
| Recommended Dosage | 25,000 International Units/m² |
| Contraindication | Hypersensitivity reactions to ERWINAZE, including anaphylaxis., pancreatitis with prior L-asparaginase therapy, thrombosis with prior L-asparaginase therapy, hemorrhagic events with prior L-asparaginase therapy. |
| Side Effects | Hypersensitivity reactions, Pancreatitis, Glucose intolerance, Thrombosis and hemorrhage |
| Useful Link | http://www.rxlist.com/erwinaze-drug.htm http://erwinaze.com/ http://www.drugs.com/erwinaze.html |
| PubMed ID | 25098829, 24436152, 23794007, 22499236 |
| 3-D Structure | Th1134 (View) or (Download) |