A database of FDA approved therapeutic peptides and proteins
| This page displays user query in tabular form. |
1662 details |
| Primary information | |
|---|---|
| ThPP ID | Th1154 |
| Therapeutic Peptide/Protein Name | OspA lipoprotein |
| Sequence | MKKYLLGIGLILALIACKQNVSSLDEKNSVSVDVPGGMKVLVSKEKNKDG view full sequnce in fasta |
| Functional Classification | IIIa |
| Molecular Weight | 27743.1 |
| Chemical Formula | C1198H2012N322O422S2 |
| Isoelectric Point | 6.72 |
| Hydrophobicity | -0.652 |
| Melting Point (℃) | N.A. |
| Half Life | 1.2 Hrs (Mammalian reticulocytes,in vitro) |
| Description | Vaccine against Lyme disease that contains lipoprotein OspA, an outer surface protein of Borrelia burgdorferi sensu stricto ZS7, as expressed by Escherichia coli. Lipoprotein OspA is a single polypeptide chain of 257 amino acids with lipids covalently bonded to the N terminus. It is conjugated with alum (aluminum hydroxide) as an adjuvant. |
| Indication/Disease | For prophylactic treatment of Lyme Disease |
| Pharmacodynamics | OspA lipoprotein is a single polypeptide chain of 270 amino acids. It is a vaccination used to prevent Lyme Disease. |
| Mechanism of Action | OspA lipoprotein, an outer surface protein of the bacteria Borrelia burgdorferi sensu stricto ZS7, is used to stimulate the production of specific antibodies against B. burgdorferi. It is used as a vaccination against Lyme Disease, a disease carried by ticks. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Vaccines |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | Toll-like receptor 2 |
| Information of corresponding available drug in the market | |
| Brand Name | Lymerix |
| Company | SmithKline Beecham |
| Brand Discription | The causative agent of Lyme disease is Borrelia burgdorferi; in North America, all Lyme disease is due to Borrelia burgdorferi sensu stricto. The vaccine contains lipoprotein OspA, an outer surface protein of Borrelia burgdorferi sensu stricto ZS7, as expressed by Escherichia coli. The vaccine is adsorbed onto aluminum hydroxide |
| Prescribed for | YMErix (lipoprotein outer surface a vaccine) is indicated for active immunization against Lyme disease in individuals 15 to 70 years of age. |
| Chemical Name | N.A. |
| Formulation | Each 0.5 mL dose of vaccine consists of 30 mcg of lipoprotein OspA adsorbed onto 0.5 mg aluminum as aluminum hydroxide adjuvant. Each dose of the vaccine preparation contains 10 mM phosphate buffered saline and 2.5 mg of 2-phenoxyethanol, a bacteriostatic agent. |
| Physcial Appearnce | LYMErix (lipoprotein outer surface a vaccine) is supplied as a sterile suspension |
| Route of Administration | Intramuscular Injection |
| Recommended Dosage | Primary immunization against Lyme disease consists of a 30 mcg/0.5 mL dose of LYMErix (lipoprotein outer surface a vaccine) given at 0, 1 and 12 months. |
| Contraindication | LYMErix (lipoprotein outer surface a vaccine) is contraindicated in people with known hypersensitivity to any component of the vaccine. |
| Side Effects | Hyperntension, Diarrhea, Arthritis, Backpain, Depression, Sinusitis, Rashes, Headache, Dizziness, Depression, Fever, Fatigue. |
| Useful Link | http://www.rxlist.com/lymerix-drug.htm |
| PubMed ID | 9261945, 8418068 |
| 3-D Structure | Th1154 (View) or (Download) |