A database of FDA approved therapeutic peptides and proteins
| This page displays user query in tabular form. |
1673 details |
| Primary information | |
|---|---|
| ThPP ID | Th1160 |
| Therapeutic Peptide/Protein Name | Satumomab Pendetide |
| Sequence | Heavy Chain 1: QVQLQQSDAELVKPGASVKISCKASGYTFTDHAIH view full sequnce in fasta |
| Functional Classification | IV |
| Molecular Weight | 141478.9 |
| Chemical Formula | C6268H9708N1666O1971S48 |
| Isoelectric Point | 7.02 |
| Hydrophobicity | -0.427 |
| Melting Point (℃) | 61 (FAB fr |
| Half Life | 0.80 hours(Mammalian reticulocytes) |
| Description | Tumor associated glycoprotein (TAG) 72 (B72.3) monoclonal antibody conjugated with Indium 111 for radioimaging colon tumors. Satumomab Pendetide (trade name: OncoScint) is no longer commercially available. |
| Indication/Disease | For diagnosis of extrahepatic malignant cancers |
| Pharmacodynamics | Binds to the tumor associated glycoprotein 72 antigen, which is a cell surface protein generally over-expressed in colorectal cancers. The radioactive Indium 111, which is covalently attached to the antibody, allows radiodiagnostic detection of TAG-72 expressing cells and tumors |
| Mechanism of Action | Satumomab Pendetide is a monoclonal antibody which is attached to the chelator pentetic acid (DTPA) linked to the tripeptide glycine (G) – L-tyrosine (Y) – L-lysine (K), which chelates Indium 111. Satumomab pendetide binds selectively to cell-surface TAG-72 expressed on colorectal tumors. |
| Toxicity | N.A. |
| Metabolism | Most likely removed by opsonization via the reticuloendothelial system or by human antimurine antibody production |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Diagnostic Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | Tumor-associated glycoprotein 72 (TAG-72) |
| Information of corresponding available drug in the market | |
| Brand Name | OncoScint |
| Company | Cytogen Corp, Lonza Biologics |
| Brand Discription | N.A. |
| Prescribed for | Extrahepatic malignant disease (diagnosis)—Indium In 111 satumomab pendetide is indicated for use in immunoscintigraphy in patients with known colorectal or ovarian cancer. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearnce | N.A. |
| Route of Administration | Intravenous Injection |
| Recommended Dosage | Estimated dose- 0.32 mSv/MBq |
| Contraindication | N.A. |
| Side Effects | Chillls, Diarrhea, Dizziness, Flushing of Skin, Allergic reactions, confusion, hypertension, Skin rashes, hypothermia, nausea, headache. |
| Useful Link | http://www.drugs.com/mmx/oncoscint-cr-ov.html |
| PubMed ID | 9755434 |
| 3-D Structure | Th1160 (View) or (Download) |