A database of FDA approved therapeutic peptides and proteins
| This page displays user query in tabular form. |
1834 details |
| Primary information | |
|---|---|
| ThPP ID | Th1223 |
| Therapeutic Peptide/Protein Name | Chorionic Gonadotropin (Human) |
| Sequence | Alpha Chain: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAY view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting Point (℃) | NA |
| Half Life | NA |
| Description | Human chorionic gonadotropin (HCG), a polypeptide hormone produced by the human placenta. Endogenously produced HCG interacts with the LHCG receptor of the ovary and promotes the maintenance of the corpus luteum during the beginning of pregnancy. This allows the corpus luteum to continuously secrete the hormone progesterone during the first trimester, which is required for maintenance of the uterus and prevents menstruation. In males, HCG also stimulates the production of gonadal steroid hormones by stimulating the interstitial cells (Leydig cells) of the testis to produce androgens. HCG is composed of an alpha and a beta sub-unit. The alpha sub-unit is essentially identical to the alpha sub units of the human pituitary gonadotropins, luteinizing hormone (LH) and follicle-stimulating hormone (FSH), as well as to the alpha sub-unit of human thyroid-stimulating hormone (TSH), while the beta sub units of these hormones differ in amino acid sequence. As a drug product, chorionic gonadotropin is a highly purified pyrogen-free preparation obtained from the urine of pregnant females. |
| Indication/Disease | For the treatment of prepubertal cryptorchidism (not due to anatomical obstruction), for the treatment of selected cases of hypogonadotropic hypogonadism (hypogonadism secondary to a pituitary deficiency) in males and for the induction of ovulation and pregnancy in the anovulatory, infertile woman in whom the cause of anovulation is secondary and not due to primary ovarian failure, and who has been appropriately pretreated with human menotropins. |
| Pharmacodynamics | he action of HCG is virtually identical to that of pituitary LH, although HCG appears to have a small degree of FSH activity as well. It stimulates production of gonadal steroid hormones by stimulating the interstitial cells (Leydig cells) of the testis to produce androgens and the corpus luteum of the ovary to produce progesterone. |
| Mechanism of Action | NA |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| Volume of Distribution | NA |
| Clearance | NA |
| Categories | Hormones |
| Patents Number | US6706681 |
| Date of Issue | 16/03/01 |
| Date of Expiry | 16/03/21 |
| Drug Interaction | NA |
| Target | Lutropin-choriogonadotropic hormone receptor |
| Information of corresponding available drug in the market | |
| Brand Name | Pregnyl |
| Company | Physicians Total Care, Inc. |
| Brand Discription | PREGNYL® (chorionic gonadotropin for injection USP) is a highly purified pyrogen-free preparation obtained from the urine of pregnant females. |
| Prescribed for | It is used for treating fertility problems in certain women who have not gone through menopause. Treating certain testicular development problems and stimulating the development of secondary sexual characteristics in certain patients. It is also used to treat boys 4 to 9 years old who have testicles that have not moved into the scrotum. |
| Chemical Name | NA |
| Formulation | Available in vials containing 10,000 USP units of sterile dried powder with 5 mg monobasic sodium phosphate and 4.4 mg dibasic sodium phosphate. If required, pH is adjusted with sodium hydroxide and/or phosphoric acid. Each package also contains a 10-mL vial of solvent containing: water for injection with 0.56% sodium chloride and 0.9% BENZYL ALCOHOL, WHICH IS NOT FOR USE IN NEWBORNS. If required, pH is adjusted with sodium hydroxide and/or hydrochloric acid. |
| Physcial Appearnce | Injection, Solution |
| Route of Administration | Intramuscular, Subcutaneous |
| Recommended Dosage | 4000 USP units 3 times weekly for 3 weeks. |
| Contraindication | Precocious puberty, prostatic carcinoma or other androgen-dependent neoplasm, prior allergic reaction to HCG. |
| Side Effects | Headache, irritability, restlessness, depression, fatigue, edema, precocious puberty, gynecomastia, pain at the site of injection. |
| Useful Link | http://www.rxlist.com/pregnyl-drug.htm , https://www.drugs.com/cdi/pregnyl.html , http://www.webmd.com/drugs/2/drug-6990/pregnyl-intramuscular/details |
| PubMed ID | 12928375, 10636378 |
| 3-D Structure | Th1223 (View) or (Download) |