A database of FDA approved therapeutic peptides and proteins
| This page displays user query in tabular form. |
1835 details |
| Primary information | |
|---|---|
| ThPP ID | Th1224 |
| Therapeutic Peptide/Protein Name | Chorionic Gonadotropin (Recombinant) |
| Sequence | Alpha chain : APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRA view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 25719.7 |
| Chemical Formula | C1105H1770N318O336S26 |
| Isoelectric Point | 8.61 |
| Hydrophobicity | -0.258 |
| Melting Point (℃) | 55 °C |
| Half Life | The mean terminal half-life is about 29 ± 6 hours (initial half-life is 4.5 ± 0.5 hours). |
| Description | Recombinant human chorionic gonadotropin with 2 subunits, alpha = 92 residues, beta = 145 residues, each with N-and O-linked carbohydrate moieties linked to ASN-52 and ASN-78 (on alpha subunit) and ASN-13, ASN-30, SER-121, SER-127, SER-132 and SER-138 (on beta subunit). The primary structure of the alpha-chain of r-hCG is identical to that of the alpha-chain of hCG, FSH and LH. |
| Indication/Disease | For the treatment of female infertility |
| Pharmacodynamics | Choriogonadotropin alfa is used to treat female infertility, Choriogonadotropin alfa stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Ovidrel is an analogue of Luteinizing Hormone (LH) and binds to the LH/hCG receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge. |
| Mechanism of Action | Choriogonadotropin alfa binds to the Follicle stimulating hormone receptor which results in ovulation in the absence of sufficient endogenous Luteinizing hormone. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | The mean absolute bioavailability following a single subcutaneous injection to healthy female volunteers is about 40%. |
| Volume of Distribution | 5.9 ± 1.0 L |
| Clearance | 0.29 +/- 0.04 L/h [healthy down-regulated females] |
| Categories | Hormones |
| Patents Number | US5767251 |
| Date of Issue | 16/06/95 |
| Date of Expiry | 16/06/15 |
| Drug Interaction | NA |
| Target | Lutropin-choriogonadotropic hormone receptor, Follicle-stimulating hormone receptor |
| Information of corresponding available drug in the market | |
| Brand Name | Ovitrelle |
| Company | Merck Serono Europe Limited |
| Brand Discription | Ovitrelle is a medicine that contains the active substance choriogonadotropin alfa |
| Prescribed for | Ovitrelle is indicated in the treatment of:women undergoing superovulation prior to assisted reproductive techniques such as in vitro fertilisation (IVF): Ovitrelle is administered to trigger final follicular maturation and luteinisation after stimulation of follicular growth;anovulatory or oligo-ovulatory women: Ovitrelle is administered to trigger ovulation and luteinisation in anovulatory or oligo-ovulatory patients after stimulation of follicular growth. |
| Chemical Name | NA |
| Formulation | Each pre-filled syringe contains 250 micrograms choriogonadotropin alfa* (equivalent to approximately 6,500 IU) in 0.5 mL solution |
| Physcial Appearnce | powder and solvent to be made up into a solution |
| Route of Administration | Subcutaneous |
| Recommended Dosage | One pre-filled syringe of Ovitrelle (250 micrograms) is administered 24 to 48 hours after the last administration of a follicle stimulating hormone (FSH) or human menopausal gonadotropin (hMG) preparation, i.e. when optimal stimulation of follicular growth is achieved. |
| Contraindication | hypersensitive (allergic) to choriogonadotropin alfa or any of the other ingredients. |
| Side Effects | The most common side effects with Ovitrelle (seen in between 1 and 10 patients in 100) are reactions at the injection site, headache, tiredness, vomiting, nausea (feeling sick), abdominal pain (stomach ache) and ovarian hyperstimulation syndrome (such as feeling sick, weight gain and diarrhoea). Ovarian hyperstimulation syndrome occurs when the ovaries over respond to treatment, especially when medicines to trigger ovulation have been used. |
| Useful Link | https://www.drugs.com/uk/ovitrelle.html , https://www.medicines.org.uk/emc/medicine/14386 |
| PubMed ID | 12928375, 10636378 |
| 3-D Structure | Th1224 (View) or (Download) |