Detailed description page of THPdb

Details of Th1016 which contains 3 entries.

Entry 1
(1) Primary information
ID 1117
ThPP ID Th1016
Therapeutic Peptide/Protein Name Pegfilgrastim
Sequence MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVL view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18802.8
Chemical Formula C845H1343N223O243S9
Isoelectric Point 5.65
Hydrophobicity 0.209
Melting Point (℃) 60
Half Life 15-80 hours
Description PEGylated(at N terminus) form of human G-CSF (Granulocyte colony stimulating factor), 175 residues, produced from E. coli via bacterial fermentation.
Indication/Disease Increases leukocyte production, for treatment in non-myeloid cancer, neutropenia and bone marrow transplant
Pharmacodynamics Used in the treatment of chemotherapy-induced neutropenia by enhancing the production of neutrophils. Pegfilgrastim acts on hematopoietic cells by binding to specific cell surface receptors thereby stimulating proliferation, differentiation, commitment and end cell functional activation. Pegfilgrastim has reduced renal clearance and prolonged persistence in vivo as compared to Filgrastim.
Mechanism of Action Pegfilgrastim binds to the G-CSF receptor. As a G-CSF analog, it controls proliferation of committed progenitor cells and influences their maturation into mature neutrophils. Pegfilgrastim also stimulates the release of neutrophils from bone marrowstorage pools and reduces their maturation time. Pegfilgrastim acts to increase the phagocytic activity of mature neutrophils. In patients receiving cytotoxic chemotherapy, pegfilgrastim can accelerate neutrophil recovery, leading to a reduction in duration of the neutropenic phase
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance Filgrastim is primarily eliminated by the kidney and neutrophils/neutrophil precursors; the latter presumably involves binding of the growth factor to the G-CSF receptor on the cell surface, internalization of the growth factor-receptor complexes via endo
Categories Immunosuppressive Agents
Patents Number CA1341537
Date of Issue 31/07/07
Date of Expiry 31/07/24
Drug Interaction N.A.
Target Granulocyte colony-stimulating factor receptor,Neutrophil elastase
Information of corresponding available drug in the market
Brand Name Neulasta
Company Amgen Inc.
Brand Discription Neulasta is a covalent conjugate of recombinant methionyl human G-CSF/Filgrastim and monomethoxypolyethylene glycol. Filgrastim (175 amino acid, 19 kilodaltons (kD)) is a water-soluble protein. Filgrastim is obtained from the bacterial fermentation of a s
Prescribed for Neulasta is used to prevent neutropenia(lack of certain white blood cells caused by receiving chemotherapy).
Chemical Name N.A.
Formulation Supplied in 0.6 mL prefilled syringes. Each syringe contains 6 mg pegfilgrastim (based on protein weight) in a sterile, clear, colorless, preservative-free solution (pH 4.0) containing acetate (0.35 mg), polysorbate 20 (0.02 mg), sodium (0.02 mg), and sor
Physcial Appearance Solution
Route of Administration Subcutaneous Injection
Recommended Dosage Single subcutaneous injection of 6 mg administered once per chemotherapy cycle in adults. Do not administer Neulasta between 14 days before and 24 hours after administration of cytotoxic chemotherapy.
Contraindication Allergy, or having sickle cell disorder; chronic myeloid leukemia; myelodysplasia (also called preleukemia); or if you are allergic to latex.
Side Effects Bone pain; pain in your arms or legs; or bruising, swelling, pain, redness, or a hard lump where the injection was given.
Useful Link http://www.drugs.com/neulasta.html
PubMed ID 21456630, 25594147, 25581410, 25524005
3-D Structure Th1016 (View) or (Download)

Entry 2
(2) Primary information
ID 1118
ThPP ID Th1016
Therapeutic Peptide/Protein Name Pegfilgrastim
Sequence MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVL view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18802.8
Chemical Formula C845H1343N223O243S9
Isoelectric Point 5.65
Hydrophobicity 0.209
Melting Point (℃) 60
Half Life 15-80 hours
Description PEGylated(at N terminus) form of human G-CSF (Granulocyte colony stimulating factor), 175 residues, produced from E. coli via bacterial fermentation.
Indication/Disease Increases leukocyte production, for treatment in non-myeloid cancer, neutropenia and bone marrow transplant
Pharmacodynamics Used in the treatment of chemotherapy-induced neutropenia by enhancing the production of neutrophils. Pegfilgrastim acts on hematopoietic cells by binding to specific cell surface receptors thereby stimulating proliferation, differentiation, commitment and end cell functional activation. Pegfilgrastim has reduced renal clearance and prolonged persistence in vivo as compared to Filgrastim.
Mechanism of Action Pegfilgrastim binds to the G-CSF receptor. As a G-CSF analog, it controls proliferation of committed progenitor cells and influences their maturation into mature neutrophils. Pegfilgrastim also stimulates the release of neutrophils from bone marrowstorage pools and reduces their maturation time. Pegfilgrastim acts to increase the phagocytic activity of mature neutrophils. In patients receiving cytotoxic chemotherapy, pegfilgrastim can accelerate neutrophil recovery, leading to a reduction in duration of the neutropenic phase
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance Filgrastim is primarily eliminated by the kidney and neutrophils/neutrophil precursors; the latter presumably involves binding of the growth factor to the G-CSF receptor on the cell surface, internalization of the growth factor-receptor complexes via endo
Categories Antineutropenic Agents
Patents Number CA1339071
Date of Issue 29/07/97
Date of Expiry 29/07/14
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.drugs.com/drug-interactions/pegfilgrastim,neulasta-index.html?filter=2&generic_only
PubMed ID 21456630, 25594147, 25581410, 25524005
3-D Structure Th1016 (View) or (Download)

Entry 3
(3) Primary information
ID 1119
ThPP ID Th1016
Therapeutic Peptide/Protein Name Pegfilgrastim
Sequence MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVL view full sequnce in fasta
Functional Classification Ib
Molecular Weight 18802.8
Chemical Formula C845H1343N223O243S9
Isoelectric Point 5.65
Hydrophobicity 0.209
Melting Point (℃) 60
Half Life 15-80 hours
Description PEGylated(at N terminus) form of human G-CSF (Granulocyte colony stimulating factor), 175 residues, produced from E. coli via bacterial fermentation.
Indication/Disease Increases leukocyte production, for treatment in non-myeloid cancer, neutropenia and bone marrow transplant
Pharmacodynamics Used in the treatment of chemotherapy-induced neutropenia by enhancing the production of neutrophils. Pegfilgrastim acts on hematopoietic cells by binding to specific cell surface receptors thereby stimulating proliferation, differentiation, commitment and end cell functional activation. Pegfilgrastim has reduced renal clearance and prolonged persistence in vivo as compared to Filgrastim.
Mechanism of Action Pegfilgrastim binds to the G-CSF receptor. As a G-CSF analog, it controls proliferation of committed progenitor cells and influences their maturation into mature neutrophils. Pegfilgrastim also stimulates the release of neutrophils from bone marrowstorage pools and reduces their maturation time. Pegfilgrastim acts to increase the phagocytic activity of mature neutrophils. In patients receiving cytotoxic chemotherapy, pegfilgrastim can accelerate neutrophil recovery, leading to a reduction in duration of the neutropenic phase
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance Filgrastim is primarily eliminated by the kidney and neutrophils/neutrophil precursors; the latter presumably involves binding of the growth factor to the G-CSF receptor on the cell surface, internalization of the growth factor-receptor complexes via endo
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.rxlist.com/neulasta-drug/indications-dosage.htm
PubMed ID 21456630, 25594147, 25581410, 25524005
3-D Structure Th1016 (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

(1) Primary information
Entry 1
ID	1117
ThPP ID	Th1016
Therapeutic Peptide/Protein Name	Pegfilgrastim
Sequence	MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVL view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18802.8
Chemical Formula	C845H1343N223O243S9
Isoelectric Point	5.65
Hydrophobicity	0.209
Melting Point (℃)	60
Half Life	15-80 hours
Description	PEGylated(at N terminus) form of human G-CSF (Granulocyte colony stimulating factor), 175 residues, produced from E. coli via bacterial fermentation.
Indication/Disease	Increases leukocyte production, for treatment in non-myeloid cancer, neutropenia and bone marrow transplant
Pharmacodynamics	Used in the treatment of chemotherapy-induced neutropenia by enhancing the production of neutrophils. Pegfilgrastim acts on hematopoietic cells by binding to specific cell surface receptors thereby stimulating proliferation, differentiation, commitment and end cell functional activation. Pegfilgrastim has reduced renal clearance and prolonged persistence in vivo as compared to Filgrastim.
Mechanism of Action	Pegfilgrastim binds to the G-CSF receptor. As a G-CSF analog, it controls proliferation of committed progenitor cells and influences their maturation into mature neutrophils. Pegfilgrastim also stimulates the release of neutrophils from bone marrowstorage pools and reduces their maturation time. Pegfilgrastim acts to increase the phagocytic activity of mature neutrophils. In patients receiving cytotoxic chemotherapy, pegfilgrastim can accelerate neutrophil recovery, leading to a reduction in duration of the neutropenic phase
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	Filgrastim is primarily eliminated by the kidney and neutrophils/neutrophil precursors; the latter presumably involves binding of the growth factor to the G-CSF receptor on the cell surface, internalization of the growth factor-receptor complexes via endo
Categories	Immunosuppressive Agents
Patents Number	CA1341537
Date of Issue	31/07/07
Date of Expiry	31/07/24
Drug Interaction	N.A.
Target	Granulocyte colony-stimulating factor receptor,Neutrophil elastase
Information of corresponding available drug in the market
Brand Name	Neulasta
Company	Amgen Inc.
Brand Discription	Neulasta is a covalent conjugate of recombinant methionyl human G-CSF/Filgrastim and monomethoxypolyethylene glycol. Filgrastim (175 amino acid, 19 kilodaltons (kD)) is a water-soluble protein. Filgrastim is obtained from the bacterial fermentation of a s
Prescribed for	Neulasta is used to prevent neutropenia(lack of certain white blood cells caused by receiving chemotherapy).
Chemical Name	N.A.
Formulation	Supplied in 0.6 mL prefilled syringes. Each syringe contains 6 mg pegfilgrastim (based on protein weight) in a sterile, clear, colorless, preservative-free solution (pH 4.0) containing acetate (0.35 mg), polysorbate 20 (0.02 mg), sodium (0.02 mg), and sor
Physcial Appearance	Solution
Route of Administration	Subcutaneous Injection
Recommended Dosage	Single subcutaneous injection of 6 mg administered once per chemotherapy cycle in adults. Do not administer Neulasta between 14 days before and 24 hours after administration of cytotoxic chemotherapy.
Contraindication	Allergy, or having sickle cell disorder; chronic myeloid leukemia; myelodysplasia (also called preleukemia); or if you are allergic to latex.
Side Effects	Bone pain; pain in your arms or legs; or bruising, swelling, pain, redness, or a hard lump where the injection was given.
Useful Link	http://www.drugs.com/neulasta.html
PubMed ID	21456630, 25594147, 25581410, 25524005
3-D Structure	Th1016 (View) or (Download)

(2) Primary information
Entry 2
ID	1118
ThPP ID	Th1016
Therapeutic Peptide/Protein Name	Pegfilgrastim
Sequence	MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVL view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18802.8
Chemical Formula	C845H1343N223O243S9
Isoelectric Point	5.65
Hydrophobicity	0.209
Melting Point (℃)	60
Half Life	15-80 hours
Description	PEGylated(at N terminus) form of human G-CSF (Granulocyte colony stimulating factor), 175 residues, produced from E. coli via bacterial fermentation.
Indication/Disease	Increases leukocyte production, for treatment in non-myeloid cancer, neutropenia and bone marrow transplant
Pharmacodynamics	Used in the treatment of chemotherapy-induced neutropenia by enhancing the production of neutrophils. Pegfilgrastim acts on hematopoietic cells by binding to specific cell surface receptors thereby stimulating proliferation, differentiation, commitment and end cell functional activation. Pegfilgrastim has reduced renal clearance and prolonged persistence in vivo as compared to Filgrastim.
Mechanism of Action	Pegfilgrastim binds to the G-CSF receptor. As a G-CSF analog, it controls proliferation of committed progenitor cells and influences their maturation into mature neutrophils. Pegfilgrastim also stimulates the release of neutrophils from bone marrowstorage pools and reduces their maturation time. Pegfilgrastim acts to increase the phagocytic activity of mature neutrophils. In patients receiving cytotoxic chemotherapy, pegfilgrastim can accelerate neutrophil recovery, leading to a reduction in duration of the neutropenic phase
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	Filgrastim is primarily eliminated by the kidney and neutrophils/neutrophil precursors; the latter presumably involves binding of the growth factor to the G-CSF receptor on the cell surface, internalization of the growth factor-receptor complexes via endo
Categories	Antineutropenic Agents
Patents Number	CA1339071
Date of Issue	29/07/97
Date of Expiry	29/07/14
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.drugs.com/drug-interactions/pegfilgrastim,neulasta-index.html?filter=2&generic_only
PubMed ID	21456630, 25594147, 25581410, 25524005
3-D Structure	Th1016 (View) or (Download)

(3) Primary information
Entry 3
ID	1119
ThPP ID	Th1016
Therapeutic Peptide/Protein Name	Pegfilgrastim
Sequence	MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVL view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	18802.8
Chemical Formula	C845H1343N223O243S9
Isoelectric Point	5.65
Hydrophobicity	0.209
Melting Point (℃)	60
Half Life	15-80 hours
Description	PEGylated(at N terminus) form of human G-CSF (Granulocyte colony stimulating factor), 175 residues, produced from E. coli via bacterial fermentation.
Indication/Disease	Increases leukocyte production, for treatment in non-myeloid cancer, neutropenia and bone marrow transplant
Pharmacodynamics	Used in the treatment of chemotherapy-induced neutropenia by enhancing the production of neutrophils. Pegfilgrastim acts on hematopoietic cells by binding to specific cell surface receptors thereby stimulating proliferation, differentiation, commitment and end cell functional activation. Pegfilgrastim has reduced renal clearance and prolonged persistence in vivo as compared to Filgrastim.
Mechanism of Action	Pegfilgrastim binds to the G-CSF receptor. As a G-CSF analog, it controls proliferation of committed progenitor cells and influences their maturation into mature neutrophils. Pegfilgrastim also stimulates the release of neutrophils from bone marrowstorage pools and reduces their maturation time. Pegfilgrastim acts to increase the phagocytic activity of mature neutrophils. In patients receiving cytotoxic chemotherapy, pegfilgrastim can accelerate neutrophil recovery, leading to a reduction in duration of the neutropenic phase
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	Filgrastim is primarily eliminated by the kidney and neutrophils/neutrophil precursors; the latter presumably involves binding of the growth factor to the G-CSF receptor on the cell surface, internalization of the growth factor-receptor complexes via endo
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.rxlist.com/neulasta-drug/indications-dosage.htm
PubMed ID	21456630, 25594147, 25581410, 25524005
3-D Structure	Th1016 (View) or (Download)