Detailed description page of THPdb

Details of Th1017 which contains 9 entries.

Entry 1
(1) Primary information
ID 1120
ThPP ID Th1017
Therapeutic Peptide/Protein Name Sargramostim
Sequence APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQ view full sequnce in fasta
Functional Classification Ib
Molecular Weight 14434.5
Chemical Formula C639H1006N168O196S8
Isoelectric Point 5.05
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life N.A.
Description Sargramostim (127 residue glycoprotein) is a human recombinant granulocyte macrophage colony-stimulating factor expressed in yeast system. Substitution of Leu23 leads to a difference from native protein.
Indication/Disease Used to treat cancer and in bone marrow transplant
Pharmacodynamics Sargramostim is used in the treatment of bone marrow transplant recipients or those exposed to chemotherapy and recovering from acute myelogenous leukemia, Leukine or GM-CSF is a hematopoietic growth factor which stimulates the survival, clonal expansion (proliferation) and differentiation of hematopoietic progenitor cells. GM-CSF is also capable of activating mature granulocytes and macrophages. After a bone marrow transplant or chemotherapy, patients have a reduced capacity to produce red and white blood cells. Supplementing them with external sources of GM-CSF helps bring the level of neutrophils back to normal so that they can better fight infections.
Mechanism of Action Sargramostim binds to the Granulocyte-macrophage colony stimulating factor receptor which stimulates a JAK2 STAT1/STAT3 signal transduction pathway which leads to the production of hemopoietic cells and neutrophils
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 420 mL/min/m2 [Normal people with liquid LEUKINE (IV)]
Categories Immunosuppressive Agents
Patents Number CA1341150
Date of Issue 05/12/00
Date of Expiry 05/12/17
Drug Interaction N.A.
Target Granulocyte-macrophage colony-stimulating factor receptor subunit alpha,Interleukin-3 receptor subunit alpha,Cytokine receptor common subunit beta,Syndecan-2,Bone marrow proteoglycan
Information of corresponding available drug in the market
Brand Name Leucomax
Company Novartis
Brand Discription Leucomax contains a chemical which stimulates the colonies of white stem cells within the bone marrow causing the level of granulocytes in the blood to rise. Increasing the levels of granulocytes in the blood stream reduced the risk and severity of infe
Prescribed for Used for reducing severe, life-threatening, or fatal infections after chemotherapy for acute myelogenous leukemia. It is also used to help increase the success of autologous bone marrow transplant and to help increase survival in patients who have bone ma
Chemical Name N.A.
Formulation N.A.
Physcial Appearance Solution
Route of Administration Subcutaneous and Intravenous infusion
Recommended Dosage In case of Intravenous Chemotherapy-induced neutropenia in adultS, 250 mcg/m2 daily for up to 42 days as required, to be given as IV infusion over 4 hr and in case of Intravenous Treatment and prevention of neutropenia in patients receiving myelosuppressivec chemotherapy.
Contraindication N.A.
Side Effects It is common to have aching bones and joints for 2-3 days starting 1-2 days after the start of the injections. This is usually mild and is caused by the bone marrow working harder to make white cells. Occasionally it is more troublesome and pain killers are required.
Useful Link http://www.cancernet.co.uk/leucomax.htm
PubMed ID 25416452, 25270293, 15583528, 25270293, 27838641, 27783330, 27576783, 27619199, 27141384
3-D Structure Th1017 (View) or (Download)

Entry 2
(2) Primary information
ID 1121
ThPP ID Th1017
Therapeutic Peptide/Protein Name Sargramostim
Sequence APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQ view full sequnce in fasta
Functional Classification Ib
Molecular Weight 14434.5
Chemical Formula C639H1006N168O196S8
Isoelectric Point 5.05
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life N.A.
Description Sargramostim (127 residue glycoprotein) is a human recombinant granulocyte macrophage colony-stimulating factor expressed in yeast system. Substitution of Leu23 leads to a difference from native protein.
Indication/Disease Used to treat cancer and in bone marrow transplant
Pharmacodynamics Sargramostim is used in the treatment of bone marrow transplant recipients or those exposed to chemotherapy and recovering from acute myelogenous leukemia, Leukine or GM-CSF is a hematopoietic growth factor which stimulates the survival, clonal expansion (proliferation) and differentiation of hematopoietic progenitor cells. GM-CSF is also capable of activating mature granulocytes and macrophages. After a bone marrow transplant or chemotherapy, patients have a reduced capacity to produce red and white blood cells. Supplementing them with external sources of GM-CSF helps bring the level of neutrophils back to normal so that they can better fight infections.
Mechanism of Action Sargramostim binds to the Granulocyte-macrophage colony stimulating factor receptor which stimulates a JAK2 STAT1/STAT3 signal transduction pathway which leads to the production of hemopoietic cells and neutrophils
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 431 mL/min/m2 [Normal people with lyophilized LEUKINE (IV)]
Categories Immunosuppressive Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Occasionally irritation at the injection site.
Useful Link http://www.igenericdrugs.com/?s=leucomax%20%28novartis%29
PubMed ID 25416452, 25270293, 15583528, 25270293, 27838641, 27783330, 27576783, 27619199, 27141384
3-D Structure Th1017 (View) or (Download)

Entry 3
(3) Primary information
ID 1122
ThPP ID Th1017
Therapeutic Peptide/Protein Name Sargramostim
Sequence APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQ view full sequnce in fasta
Functional Classification Ib
Molecular Weight 14434.5
Chemical Formula C639H1006N168O196S8
Isoelectric Point 5.05
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life N.A.
Description Sargramostim (127 residue glycoprotein) is a human recombinant granulocyte macrophage colony-stimulating factor expressed in yeast system. Substitution of Leu23 leads to a difference from native protein.
Indication/Disease Used to treat cancer and in bone marrow transplant
Pharmacodynamics Sargramostim is used in the treatment of bone marrow transplant recipients or those exposed to chemotherapy and recovering from acute myelogenous leukemia, Leukine or GM-CSF is a hematopoietic growth factor which stimulates the survival, clonal expansion (proliferation) and differentiation of hematopoietic progenitor cells. GM-CSF is also capable of activating mature granulocytes and macrophages. After a bone marrow transplant or chemotherapy, patients have a reduced capacity to produce red and white blood cells. Supplementing them with external sources of GM-CSF helps bring the level of neutrophils back to normal so that they can better fight infections.
Mechanism of Action Sargramostim binds to the Granulocyte-macrophage colony stimulating factor receptor which stimulates a JAK2 STAT1/STAT3 signal transduction pathway which leads to the production of hemopoietic cells and neutrophils
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 549 mL/min/m2 [Normal people with liquid LEUKINE (SC)]
Categories Immunosuppressive Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Very rarely a disturbance in the liver function blood tests.
Useful Link N.A.
PubMed ID 25416452, 25270293, 15583528, 25270293, 27838641, 27783330, 27576783, 27619199, 27141384
3-D Structure Th1017 (View) or (Download)

Entry 4
(4) Primary information
ID 1123
ThPP ID Th1017
Therapeutic Peptide/Protein Name Sargramostim
Sequence APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQ view full sequnce in fasta
Functional Classification Ib
Molecular Weight 14434.5
Chemical Formula C639H1006N168O196S8
Isoelectric Point 5.05
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life N.A.
Description Sargramostim (127 residue glycoprotein) is a human recombinant granulocyte macrophage colony-stimulating factor expressed in yeast system. Substitution of Leu23 leads to a difference from native protein.
Indication/Disease Used to treat cancer and in bone marrow transplant
Pharmacodynamics Sargramostim is used in the treatment of bone marrow transplant recipients or those exposed to chemotherapy and recovering from acute myelogenous leukemia, Leukine or GM-CSF is a hematopoietic growth factor which stimulates the survival, clonal expansion (proliferation) and differentiation of hematopoietic progenitor cells. GM-CSF is also capable of activating mature granulocytes and macrophages. After a bone marrow transplant or chemotherapy, patients have a reduced capacity to produce red and white blood cells. Supplementing them with external sources of GM-CSF helps bring the level of neutrophils back to normal so that they can better fight infections.
Mechanism of Action Sargramostim binds to the Granulocyte-macrophage colony stimulating factor receptor which stimulates a JAK2 STAT1/STAT3 signal transduction pathway which leads to the production of hemopoietic cells and neutrophils
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 529 mL/min/m2 [Normal people with lyophilized LEUKINE (SC)]
Categories Immunosuppressive Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Rare mild flu like symptom, headache, malaise, rigors & nausea.
Useful Link N.A.
PubMed ID 25416452, 25270293, 15583528, 25270293, 27838641, 27783330, 27576783, 27619199, 27141384
3-D Structure Th1017 (View) or (Download)

Entry 5
(5) Primary information
ID 1124
ThPP ID Th1017
Therapeutic Peptide/Protein Name Sargramostim
Sequence APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQ view full sequnce in fasta
Functional Classification Ib
Molecular Weight 14434.5
Chemical Formula C639H1006N168O196S8
Isoelectric Point 5.05
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life N.A.
Description Sargramostim (127 residue glycoprotein) is a human recombinant granulocyte macrophage colony-stimulating factor expressed in yeast system. Substitution of Leu23 leads to a difference from native protein.
Indication/Disease Used to treat cancer and in bone marrow transplant
Pharmacodynamics Sargramostim is used in the treatment of bone marrow transplant recipients or those exposed to chemotherapy and recovering from acute myelogenous leukemia, Leukine or GM-CSF is a hematopoietic growth factor which stimulates the survival, clonal expansion (proliferation) and differentiation of hematopoietic progenitor cells. GM-CSF is also capable of activating mature granulocytes and macrophages. After a bone marrow transplant or chemotherapy, patients have a reduced capacity to produce red and white blood cells. Supplementing them with external sources of GM-CSF helps bring the level of neutrophils back to normal so that they can better fight infections.
Mechanism of Action Sargramostim binds to the Granulocyte-macrophage colony stimulating factor receptor which stimulates a JAK2 STAT1/STAT3 signal transduction pathway which leads to the production of hemopoietic cells and neutrophils
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Immunosuppressive Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Rare mild itching and occasional skin rash.
Useful Link N.A.
PubMed ID 25416452, 25270293, 15583528, 25270293, 27838641, 27783330, 27576783, 27619199, 27141384
3-D Structure Th1017 (View) or (Download)

Entry 6
(6) Primary information
ID 1125
ThPP ID Th1017
Therapeutic Peptide/Protein Name Sargramostim
Sequence APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQ view full sequnce in fasta
Functional Classification Ib
Molecular Weight 14434.5
Chemical Formula C639H1006N168O196S8
Isoelectric Point 5.05
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life N.A.
Description Sargramostim (127 residue glycoprotein) is a human recombinant granulocyte macrophage colony-stimulating factor expressed in yeast system. Substitution of Leu23 leads to a difference from native protein.
Indication/Disease Used to treat cancer and in bone marrow transplant
Pharmacodynamics Sargramostim is used in the treatment of bone marrow transplant recipients or those exposed to chemotherapy and recovering from acute myelogenous leukemia, Leukine or GM-CSF is a hematopoietic growth factor which stimulates the survival, clonal expansion (proliferation) and differentiation of hematopoietic progenitor cells. GM-CSF is also capable of activating mature granulocytes and macrophages. After a bone marrow transplant or chemotherapy, patients have a reduced capacity to produce red and white blood cells. Supplementing them with external sources of GM-CSF helps bring the level of neutrophils back to normal so that they can better fight infections.
Mechanism of Action Sargramostim binds to the Granulocyte-macrophage colony stimulating factor receptor which stimulates a JAK2 STAT1/STAT3 signal transduction pathway which leads to the production of hemopoietic cells and neutrophils
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Immunosuppressive Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name Leukine
Company Berlex Laboratories Inc
Brand Discription LEUKINE is a recombinant human granulocyte macrophage colony stimulating factor produced by recombinant DNA technology in a yeast expression system. GM-CSF is a hematopoietic growth stimulating factor which stimulates proliferation and differentiation of
Prescribed for Leukine is used to increase white blood cells and help prevent serious infection in conditions such as leukemia, bone marrow transplant, and pre-chemotherapy blood cell collection. Leukine is used for adults who are at least 55 years old.
Chemical Name N.A.
Formulation The liquid vial and reconstituted lyophilized vial both contain 40 mg/mL mannitol, USP; 10 mg/mL sucrose, NF; and 1.2 mg/mL tromethamine, USP, as excipients
Physcial Appearance Sterile, preserved (1.1% benzyl alcohol), injectable solution (500 mcg/mL) and also as sterile, white, preservative free lyophilized powder (250 mcg) that requires reconstitution with 1 mL Sterile water for Injection
Route of Administration Subcutaneous Injection (Subcutaneous) or Intraveno
Recommended Dosage In Neutrophil Recovery, Chemotherapy in Acute Myelogenous Leukemia, the recommended dose is 250 mcg/m2/day, administered intravenously over a 4 hour period starting approximately on day 11 or four days following the completion of induction chemotherapy, , if the day 10 bone marrow is hypoplastic with <5% blasts.
Contraindication Allergy
Side Effects High fever, chills, sore throat, stuffy nose, flu symptoms; white patches or sores inside your mouth or on your lips; easy bruising, unusual bleeding (nose, mouth, vagina, or rectum), purple or red pinpoint spots under your skin; swelling, rapid weight gain, chest pain, fast or uneven heart rate, weakness or fainting, black-bloody or tarry stools, coughing up blood, painful urination, clay-colored stools, jaundice, breathing problems and problems with vision, speech, balance or memory.
Useful Link http://www.drugs.com/leukine.html
PubMed ID 25416452, 25270293, 15583528, 25270293, 27838641, 27783330, 27576783, 27619199, 27141384
3-D Structure Th1017 (View) or (Download)

Entry 7
(7) Primary information
ID 1126
ThPP ID Th1017
Therapeutic Peptide/Protein Name Sargramostim
Sequence APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQ view full sequnce in fasta
Functional Classification Ib
Molecular Weight 14434.5
Chemical Formula C639H1006N168O196S8
Isoelectric Point 5.05
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life N.A.
Description Sargramostim (127 residue glycoprotein) is a human recombinant granulocyte macrophage colony-stimulating factor expressed in yeast system. Substitution of Leu23 leads to a difference from native protein.
Indication/Disease Used to treat cancer and in bone marrow transplant
Pharmacodynamics Sargramostim is used in the treatment of bone marrow transplant recipients or those exposed to chemotherapy and recovering from acute myelogenous leukemia, Leukine or GM-CSF is a hematopoietic growth factor which stimulates the survival, clonal expansion (proliferation) and differentiation of hematopoietic progenitor cells. GM-CSF is also capable of activating mature granulocytes and macrophages. After a bone marrow transplant or chemotherapy, patients have a reduced capacity to produce red and white blood cells. Supplementing them with external sources of GM-CSF helps bring the level of neutrophils back to normal so that they can better fight infections.
Mechanism of Action Sargramostim binds to the Granulocyte-macrophage colony stimulating factor receptor which stimulates a JAK2 STAT1/STAT3 signal transduction pathway which leads to the production of hemopoietic cells and neutrophils
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Immunosuppressive Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage Mobilization of Peripheral Blood Progenitor Cells, the recommended dose is 250 mcg/m2/day administered IV over 24 hours or SC once daily.
Contraindication N.A.
Side Effects Black, bloody, or tarry stools; coughing up blood or vomit that looks like coffee grounds; painful or difficult urination; dark urine, clay-colored stools, jaundice (yellowing of the skin or eyes); breathing problems; or problems with vision, speech, balance or memory.
Useful Link http://www.drugs.com/drug-interactions/sargramostim,leukine-index.html
PubMed ID 25416452, 25270293, 15583528, 25270293, 27838641, 27783330, 27576783, 27619199, 27141384
3-D Structure Th1017 (View) or (Download)

Entry 8
(8) Primary information
ID 1127
ThPP ID Th1017
Therapeutic Peptide/Protein Name Sargramostim
Sequence APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQ view full sequnce in fasta
Functional Classification Ib
Molecular Weight 14434.5
Chemical Formula C639H1006N168O196S8
Isoelectric Point 5.05
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life N.A.
Description Sargramostim (127 residue glycoprotein) is a human recombinant granulocyte macrophage colony-stimulating factor expressed in yeast system. Substitution of Leu23 leads to a difference from native protein.
Indication/Disease Used to treat cancer and in bone marrow transplant
Pharmacodynamics Sargramostim is used in the treatment of bone marrow transplant recipients or those exposed to chemotherapy and recovering from acute myelogenous leukemia, Leukine or GM-CSF is a hematopoietic growth factor which stimulates the survival, clonal expansion (proliferation) and differentiation of hematopoietic progenitor cells. GM-CSF is also capable of activating mature granulocytes and macrophages. After a bone marrow transplant or chemotherapy, patients have a reduced capacity to produce red and white blood cells. Supplementing them with external sources of GM-CSF helps bring the level of neutrophils back to normal so that they can better fight infections.
Mechanism of Action Sargramostim binds to the Granulocyte-macrophage colony stimulating factor receptor which stimulates a JAK2 STAT1/STAT3 signal transduction pathway which leads to the production of hemopoietic cells and neutrophils
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Immunosuppressive Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage Post Peripheral Blood Progenitor Cell Transplantation, the recommended dose is 250 mcg/m2/day administered IV over 24 hours or SC once daily beginning immediately following infusion of progenitor cells and continuing until an ANC>1500 cells/mm3 for three consecutive days is attained.
Contraindication N.A.
Side Effects Nausea, stomach pain, vomiting, diarrhea, loss of appetite; tired feeling; hair loss; weight loss; headache.
Useful Link http://www.drugs.com/drug-interactions/sargramostim,leukine-index.html
PubMed ID 25416452, 25270293, 15583528, 25270293, 27838641, 27783330, 27576783, 27619199, 27141384
3-D Structure Th1017 (View) or (Download)

Entry 9
(9) Primary information
ID 1128
ThPP ID Th1017
Therapeutic Peptide/Protein Name Sargramostim
Sequence APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQ view full sequnce in fasta
Functional Classification Ib
Molecular Weight 14434.5
Chemical Formula C639H1006N168O196S8
Isoelectric Point 5.05
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life N.A.
Description Sargramostim (127 residue glycoprotein) is a human recombinant granulocyte macrophage colony-stimulating factor expressed in yeast system. Substitution of Leu23 leads to a difference from native protein.
Indication/Disease Used to treat cancer and in bone marrow transplant
Pharmacodynamics Sargramostim is used in the treatment of bone marrow transplant recipients or those exposed to chemotherapy and recovering from acute myelogenous leukemia, Leukine or GM-CSF is a hematopoietic growth factor which stimulates the survival, clonal expansion (proliferation) and differentiation of hematopoietic progenitor cells. GM-CSF is also capable of activating mature granulocytes and macrophages. After a bone marrow transplant or chemotherapy, patients have a reduced capacity to produce red and white blood cells. Supplementing them with external sources of GM-CSF helps bring the level of neutrophils back to normal so that they can better fight infections.
Mechanism of Action Sargramostim binds to the Granulocyte-macrophage colony stimulating factor receptor which stimulates a JAK2 STAT1/STAT3 signal transduction pathway which leads to the production of hemopoietic cells and neutrophils
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Immunosuppressive Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage Myeloid Reconstitution After Autologous or Allogeneic Bone Marrow Transplantation, the recommended dose is 250 mcg/m2/day administered IV over a 2-hour period beginning two to four hours after bone marrow infusion, and not less than 24 hours after the last dose of chemotherapy or radiotherapy.
Contraindication N.A.
Side Effects Mild skin rash or itching; bone pain; joint or muscle pain; or redness, swelling, or irritation where the injection was given.
Useful Link http://www.rxlist.com/leukine-drug.htm
PubMed ID 25416452, 25270293, 15583528, 25270293, 27838641, 27783330, 27576783, 27619199, 27141384
3-D Structure Th1017 (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

(1) Primary information
Entry 1
ID	1120
ThPP ID	Th1017
Therapeutic Peptide/Protein Name	Sargramostim
Sequence	APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQ view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	14434.5
Chemical Formula	C639H1006N168O196S8
Isoelectric Point	5.05
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	N.A.
Description	Sargramostim (127 residue glycoprotein) is a human recombinant granulocyte macrophage colony-stimulating factor expressed in yeast system. Substitution of Leu23 leads to a difference from native protein.
Indication/Disease	Used to treat cancer and in bone marrow transplant
Pharmacodynamics	Sargramostim is used in the treatment of bone marrow transplant recipients or those exposed to chemotherapy and recovering from acute myelogenous leukemia, Leukine or GM-CSF is a hematopoietic growth factor which stimulates the survival, clonal expansion (proliferation) and differentiation of hematopoietic progenitor cells. GM-CSF is also capable of activating mature granulocytes and macrophages. After a bone marrow transplant or chemotherapy, patients have a reduced capacity to produce red and white blood cells. Supplementing them with external sources of GM-CSF helps bring the level of neutrophils back to normal so that they can better fight infections.
Mechanism of Action	Sargramostim binds to the Granulocyte-macrophage colony stimulating factor receptor which stimulates a JAK2 STAT1/STAT3 signal transduction pathway which leads to the production of hemopoietic cells and neutrophils
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	420 mL/min/m2 [Normal people with liquid LEUKINE (IV)]
Categories	Immunosuppressive Agents
Patents Number	CA1341150
Date of Issue	05/12/00
Date of Expiry	05/12/17
Drug Interaction	N.A.
Target	Granulocyte-macrophage colony-stimulating factor receptor subunit alpha,Interleukin-3 receptor subunit alpha,Cytokine receptor common subunit beta,Syndecan-2,Bone marrow proteoglycan
Information of corresponding available drug in the market
Brand Name	Leucomax
Company	Novartis
Brand Discription	Leucomax contains a chemical which stimulates the colonies of white stem cells within the bone marrow causing the level of granulocytes in the blood to rise. Increasing the levels of granulocytes in the blood stream reduced the risk and severity of infe
Prescribed for	Used for reducing severe, life-threatening, or fatal infections after chemotherapy for acute myelogenous leukemia. It is also used to help increase the success of autologous bone marrow transplant and to help increase survival in patients who have bone ma
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	Solution
Route of Administration	Subcutaneous and Intravenous infusion
Recommended Dosage	In case of Intravenous Chemotherapy-induced neutropenia in adultS, 250 mcg/m2 daily for up to 42 days as required, to be given as IV infusion over 4 hr and in case of Intravenous Treatment and prevention of neutropenia in patients receiving myelosuppressivec chemotherapy.
Contraindication	N.A.
Side Effects	It is common to have aching bones and joints for 2-3 days starting 1-2 days after the start of the injections. This is usually mild and is caused by the bone marrow working harder to make white cells. Occasionally it is more troublesome and pain killers are required.
Useful Link	http://www.cancernet.co.uk/leucomax.htm
PubMed ID	25416452, 25270293, 15583528, 25270293, 27838641, 27783330, 27576783, 27619199, 27141384
3-D Structure	Th1017 (View) or (Download)

(2) Primary information
Entry 2
ID	1121
ThPP ID	Th1017
Therapeutic Peptide/Protein Name	Sargramostim
Sequence	APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQ view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	14434.5
Chemical Formula	C639H1006N168O196S8
Isoelectric Point	5.05
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	N.A.
Description	Sargramostim (127 residue glycoprotein) is a human recombinant granulocyte macrophage colony-stimulating factor expressed in yeast system. Substitution of Leu23 leads to a difference from native protein.
Indication/Disease	Used to treat cancer and in bone marrow transplant
Pharmacodynamics	Sargramostim is used in the treatment of bone marrow transplant recipients or those exposed to chemotherapy and recovering from acute myelogenous leukemia, Leukine or GM-CSF is a hematopoietic growth factor which stimulates the survival, clonal expansion (proliferation) and differentiation of hematopoietic progenitor cells. GM-CSF is also capable of activating mature granulocytes and macrophages. After a bone marrow transplant or chemotherapy, patients have a reduced capacity to produce red and white blood cells. Supplementing them with external sources of GM-CSF helps bring the level of neutrophils back to normal so that they can better fight infections.
Mechanism of Action	Sargramostim binds to the Granulocyte-macrophage colony stimulating factor receptor which stimulates a JAK2 STAT1/STAT3 signal transduction pathway which leads to the production of hemopoietic cells and neutrophils
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	431 mL/min/m2 [Normal people with lyophilized LEUKINE (IV)]
Categories	Immunosuppressive Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Occasionally irritation at the injection site.
Useful Link	http://www.igenericdrugs.com/?s=leucomax%20%28novartis%29
PubMed ID	25416452, 25270293, 15583528, 25270293, 27838641, 27783330, 27576783, 27619199, 27141384
3-D Structure	Th1017 (View) or (Download)

(3) Primary information
Entry 3
ID	1122
ThPP ID	Th1017
Therapeutic Peptide/Protein Name	Sargramostim
Sequence	APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQ view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	14434.5
Chemical Formula	C639H1006N168O196S8
Isoelectric Point	5.05
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	N.A.
Description	Sargramostim (127 residue glycoprotein) is a human recombinant granulocyte macrophage colony-stimulating factor expressed in yeast system. Substitution of Leu23 leads to a difference from native protein.
Indication/Disease	Used to treat cancer and in bone marrow transplant
Pharmacodynamics	Sargramostim is used in the treatment of bone marrow transplant recipients or those exposed to chemotherapy and recovering from acute myelogenous leukemia, Leukine or GM-CSF is a hematopoietic growth factor which stimulates the survival, clonal expansion (proliferation) and differentiation of hematopoietic progenitor cells. GM-CSF is also capable of activating mature granulocytes and macrophages. After a bone marrow transplant or chemotherapy, patients have a reduced capacity to produce red and white blood cells. Supplementing them with external sources of GM-CSF helps bring the level of neutrophils back to normal so that they can better fight infections.
Mechanism of Action	Sargramostim binds to the Granulocyte-macrophage colony stimulating factor receptor which stimulates a JAK2 STAT1/STAT3 signal transduction pathway which leads to the production of hemopoietic cells and neutrophils
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	549 mL/min/m2 [Normal people with liquid LEUKINE (SC)]
Categories	Immunosuppressive Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Very rarely a disturbance in the liver function blood tests.
Useful Link	N.A.
PubMed ID	25416452, 25270293, 15583528, 25270293, 27838641, 27783330, 27576783, 27619199, 27141384
3-D Structure	Th1017 (View) or (Download)

(4) Primary information
Entry 4
ID	1123
ThPP ID	Th1017
Therapeutic Peptide/Protein Name	Sargramostim
Sequence	APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQ view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	14434.5
Chemical Formula	C639H1006N168O196S8
Isoelectric Point	5.05
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	N.A.
Description	Sargramostim (127 residue glycoprotein) is a human recombinant granulocyte macrophage colony-stimulating factor expressed in yeast system. Substitution of Leu23 leads to a difference from native protein.
Indication/Disease	Used to treat cancer and in bone marrow transplant
Pharmacodynamics	Sargramostim is used in the treatment of bone marrow transplant recipients or those exposed to chemotherapy and recovering from acute myelogenous leukemia, Leukine or GM-CSF is a hematopoietic growth factor which stimulates the survival, clonal expansion (proliferation) and differentiation of hematopoietic progenitor cells. GM-CSF is also capable of activating mature granulocytes and macrophages. After a bone marrow transplant or chemotherapy, patients have a reduced capacity to produce red and white blood cells. Supplementing them with external sources of GM-CSF helps bring the level of neutrophils back to normal so that they can better fight infections.
Mechanism of Action	Sargramostim binds to the Granulocyte-macrophage colony stimulating factor receptor which stimulates a JAK2 STAT1/STAT3 signal transduction pathway which leads to the production of hemopoietic cells and neutrophils
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	529 mL/min/m2 [Normal people with lyophilized LEUKINE (SC)]
Categories	Immunosuppressive Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Rare mild flu like symptom, headache, malaise, rigors & nausea.
Useful Link	N.A.
PubMed ID	25416452, 25270293, 15583528, 25270293, 27838641, 27783330, 27576783, 27619199, 27141384
3-D Structure	Th1017 (View) or (Download)

(5) Primary information
Entry 5
ID	1124
ThPP ID	Th1017
Therapeutic Peptide/Protein Name	Sargramostim
Sequence	APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQ view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	14434.5
Chemical Formula	C639H1006N168O196S8
Isoelectric Point	5.05
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	N.A.
Description	Sargramostim (127 residue glycoprotein) is a human recombinant granulocyte macrophage colony-stimulating factor expressed in yeast system. Substitution of Leu23 leads to a difference from native protein.
Indication/Disease	Used to treat cancer and in bone marrow transplant
Pharmacodynamics	Sargramostim is used in the treatment of bone marrow transplant recipients or those exposed to chemotherapy and recovering from acute myelogenous leukemia, Leukine or GM-CSF is a hematopoietic growth factor which stimulates the survival, clonal expansion (proliferation) and differentiation of hematopoietic progenitor cells. GM-CSF is also capable of activating mature granulocytes and macrophages. After a bone marrow transplant or chemotherapy, patients have a reduced capacity to produce red and white blood cells. Supplementing them with external sources of GM-CSF helps bring the level of neutrophils back to normal so that they can better fight infections.
Mechanism of Action	Sargramostim binds to the Granulocyte-macrophage colony stimulating factor receptor which stimulates a JAK2 STAT1/STAT3 signal transduction pathway which leads to the production of hemopoietic cells and neutrophils
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Immunosuppressive Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Rare mild itching and occasional skin rash.
Useful Link	N.A.
PubMed ID	25416452, 25270293, 15583528, 25270293, 27838641, 27783330, 27576783, 27619199, 27141384
3-D Structure	Th1017 (View) or (Download)

(6) Primary information
Entry 6
ID	1125
ThPP ID	Th1017
Therapeutic Peptide/Protein Name	Sargramostim
Sequence	APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQ view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	14434.5
Chemical Formula	C639H1006N168O196S8
Isoelectric Point	5.05
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	N.A.
Description	Sargramostim (127 residue glycoprotein) is a human recombinant granulocyte macrophage colony-stimulating factor expressed in yeast system. Substitution of Leu23 leads to a difference from native protein.
Indication/Disease	Used to treat cancer and in bone marrow transplant
Pharmacodynamics	Sargramostim is used in the treatment of bone marrow transplant recipients or those exposed to chemotherapy and recovering from acute myelogenous leukemia, Leukine or GM-CSF is a hematopoietic growth factor which stimulates the survival, clonal expansion (proliferation) and differentiation of hematopoietic progenitor cells. GM-CSF is also capable of activating mature granulocytes and macrophages. After a bone marrow transplant or chemotherapy, patients have a reduced capacity to produce red and white blood cells. Supplementing them with external sources of GM-CSF helps bring the level of neutrophils back to normal so that they can better fight infections.
Mechanism of Action	Sargramostim binds to the Granulocyte-macrophage colony stimulating factor receptor which stimulates a JAK2 STAT1/STAT3 signal transduction pathway which leads to the production of hemopoietic cells and neutrophils
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Immunosuppressive Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Leukine
Company	Berlex Laboratories Inc
Brand Discription	LEUKINE is a recombinant human granulocyte macrophage colony stimulating factor produced by recombinant DNA technology in a yeast expression system. GM-CSF is a hematopoietic growth stimulating factor which stimulates proliferation and differentiation of
Prescribed for	Leukine is used to increase white blood cells and help prevent serious infection in conditions such as leukemia, bone marrow transplant, and pre-chemotherapy blood cell collection. Leukine is used for adults who are at least 55 years old.
Chemical Name	N.A.
Formulation	The liquid vial and reconstituted lyophilized vial both contain 40 mg/mL mannitol, USP; 10 mg/mL sucrose, NF; and 1.2 mg/mL tromethamine, USP, as excipients
Physcial Appearance	Sterile, preserved (1.1% benzyl alcohol), injectable solution (500 mcg/mL) and also as sterile, white, preservative free lyophilized powder (250 mcg) that requires reconstitution with 1 mL Sterile water for Injection
Route of Administration	Subcutaneous Injection (Subcutaneous) or Intraveno
Recommended Dosage	In Neutrophil Recovery, Chemotherapy in Acute Myelogenous Leukemia, the recommended dose is 250 mcg/m2/day, administered intravenously over a 4 hour period starting approximately on day 11 or four days following the completion of induction chemotherapy, , if the day 10 bone marrow is hypoplastic with <5% blasts.
Contraindication	Allergy
Side Effects	High fever, chills, sore throat, stuffy nose, flu symptoms; white patches or sores inside your mouth or on your lips; easy bruising, unusual bleeding (nose, mouth, vagina, or rectum), purple or red pinpoint spots under your skin; swelling, rapid weight gain, chest pain, fast or uneven heart rate, weakness or fainting, black-bloody or tarry stools, coughing up blood, painful urination, clay-colored stools, jaundice, breathing problems and problems with vision, speech, balance or memory.
Useful Link	http://www.drugs.com/leukine.html
PubMed ID	25416452, 25270293, 15583528, 25270293, 27838641, 27783330, 27576783, 27619199, 27141384
3-D Structure	Th1017 (View) or (Download)

(7) Primary information
Entry 7
ID	1126
ThPP ID	Th1017
Therapeutic Peptide/Protein Name	Sargramostim
Sequence	APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQ view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	14434.5
Chemical Formula	C639H1006N168O196S8
Isoelectric Point	5.05
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	N.A.
Description	Sargramostim (127 residue glycoprotein) is a human recombinant granulocyte macrophage colony-stimulating factor expressed in yeast system. Substitution of Leu23 leads to a difference from native protein.
Indication/Disease	Used to treat cancer and in bone marrow transplant
Pharmacodynamics	Sargramostim is used in the treatment of bone marrow transplant recipients or those exposed to chemotherapy and recovering from acute myelogenous leukemia, Leukine or GM-CSF is a hematopoietic growth factor which stimulates the survival, clonal expansion (proliferation) and differentiation of hematopoietic progenitor cells. GM-CSF is also capable of activating mature granulocytes and macrophages. After a bone marrow transplant or chemotherapy, patients have a reduced capacity to produce red and white blood cells. Supplementing them with external sources of GM-CSF helps bring the level of neutrophils back to normal so that they can better fight infections.
Mechanism of Action	Sargramostim binds to the Granulocyte-macrophage colony stimulating factor receptor which stimulates a JAK2 STAT1/STAT3 signal transduction pathway which leads to the production of hemopoietic cells and neutrophils
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Immunosuppressive Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	Mobilization of Peripheral Blood Progenitor Cells, the recommended dose is 250 mcg/m2/day administered IV over 24 hours or SC once daily.
Contraindication	N.A.
Side Effects	Black, bloody, or tarry stools; coughing up blood or vomit that looks like coffee grounds; painful or difficult urination; dark urine, clay-colored stools, jaundice (yellowing of the skin or eyes); breathing problems; or problems with vision, speech, balance or memory.
Useful Link	http://www.drugs.com/drug-interactions/sargramostim,leukine-index.html
PubMed ID	25416452, 25270293, 15583528, 25270293, 27838641, 27783330, 27576783, 27619199, 27141384
3-D Structure	Th1017 (View) or (Download)

(8) Primary information
Entry 8
ID	1127
ThPP ID	Th1017
Therapeutic Peptide/Protein Name	Sargramostim
Sequence	APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQ view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	14434.5
Chemical Formula	C639H1006N168O196S8
Isoelectric Point	5.05
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	N.A.
Description	Sargramostim (127 residue glycoprotein) is a human recombinant granulocyte macrophage colony-stimulating factor expressed in yeast system. Substitution of Leu23 leads to a difference from native protein.
Indication/Disease	Used to treat cancer and in bone marrow transplant
Pharmacodynamics	Sargramostim is used in the treatment of bone marrow transplant recipients or those exposed to chemotherapy and recovering from acute myelogenous leukemia, Leukine or GM-CSF is a hematopoietic growth factor which stimulates the survival, clonal expansion (proliferation) and differentiation of hematopoietic progenitor cells. GM-CSF is also capable of activating mature granulocytes and macrophages. After a bone marrow transplant or chemotherapy, patients have a reduced capacity to produce red and white blood cells. Supplementing them with external sources of GM-CSF helps bring the level of neutrophils back to normal so that they can better fight infections.
Mechanism of Action	Sargramostim binds to the Granulocyte-macrophage colony stimulating factor receptor which stimulates a JAK2 STAT1/STAT3 signal transduction pathway which leads to the production of hemopoietic cells and neutrophils
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Immunosuppressive Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	Post Peripheral Blood Progenitor Cell Transplantation, the recommended dose is 250 mcg/m2/day administered IV over 24 hours or SC once daily beginning immediately following infusion of progenitor cells and continuing until an ANC>1500 cells/mm3 for three consecutive days is attained.
Contraindication	N.A.
Side Effects	Nausea, stomach pain, vomiting, diarrhea, loss of appetite; tired feeling; hair loss; weight loss; headache.
Useful Link	http://www.drugs.com/drug-interactions/sargramostim,leukine-index.html
PubMed ID	25416452, 25270293, 15583528, 25270293, 27838641, 27783330, 27576783, 27619199, 27141384
3-D Structure	Th1017 (View) or (Download)

(9) Primary information
Entry 9
ID	1128
ThPP ID	Th1017
Therapeutic Peptide/Protein Name	Sargramostim
Sequence	APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQ view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	14434.5
Chemical Formula	C639H1006N168O196S8
Isoelectric Point	5.05
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	N.A.
Description	Sargramostim (127 residue glycoprotein) is a human recombinant granulocyte macrophage colony-stimulating factor expressed in yeast system. Substitution of Leu23 leads to a difference from native protein.
Indication/Disease	Used to treat cancer and in bone marrow transplant
Pharmacodynamics	Sargramostim is used in the treatment of bone marrow transplant recipients or those exposed to chemotherapy and recovering from acute myelogenous leukemia, Leukine or GM-CSF is a hematopoietic growth factor which stimulates the survival, clonal expansion (proliferation) and differentiation of hematopoietic progenitor cells. GM-CSF is also capable of activating mature granulocytes and macrophages. After a bone marrow transplant or chemotherapy, patients have a reduced capacity to produce red and white blood cells. Supplementing them with external sources of GM-CSF helps bring the level of neutrophils back to normal so that they can better fight infections.
Mechanism of Action	Sargramostim binds to the Granulocyte-macrophage colony stimulating factor receptor which stimulates a JAK2 STAT1/STAT3 signal transduction pathway which leads to the production of hemopoietic cells and neutrophils
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Immunosuppressive Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	Myeloid Reconstitution After Autologous or Allogeneic Bone Marrow Transplantation, the recommended dose is 250 mcg/m2/day administered IV over a 2-hour period beginning two to four hours after bone marrow infusion, and not less than 24 hours after the last dose of chemotherapy or radiotherapy.
Contraindication	N.A.
Side Effects	Mild skin rash or itching; bone pain; joint or muscle pain; or redness, swelling, or irritation where the injection was given.
Useful Link	http://www.rxlist.com/leukine-drug.htm
PubMed ID	25416452, 25270293, 15583528, 25270293, 27838641, 27783330, 27576783, 27619199, 27141384
3-D Structure	Th1017 (View) or (Download)