Detailed description page of THPdb

Details of Th1020 which contains 3 entries.

Entry 1
(1) Primary information
ID 1142
ThPP ID Th1020
Therapeutic Peptide/Protein Name Asparaginase
Sequence Elspar Sequence: QMSLQQELRYIEALSAIVETGQKMLEAGESALD view full sequnce in fasta
Functional Classification Ic
Molecular Weight 31731.9
Chemical Formula C1377H2208N382O442S17
Isoelectric Point 4.67
Hydrophobicity 0.059
Melting Point (℃) N.A.
Half Life 8-30 hours
Description L-asparagine amidohydrolase from E. coli
Indication/Disease To treat acute lympocytic leukemia and non-Hodgkins lymphoma
Pharmacodynamics In most patients with acute leukemia, the malignant cells are dependent on an exogenous source of asparagine for survival. Normal cells, however, are able to synthesize asparagine and thus are affected less by the rapid depletion produced by treatment with the enzyme asparaginase. Elspar exploits a metabolic defect in asparagine synthesis of some malignant cells.
Mechanism of Action Asparaginase converts asparagine to aspartic acid and ammonia. It facilitates production of oxalo-acetate which is needed for general cellular metabolism. Some malignant cells lose the ability to produce asparagine and thus the loss of exogenous sources of asparagine leads to cell death.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Antineoplastic Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Trastuzumab may increase the risk of neutropenia and anemia. Monitor closely for signs and symptoms of adverse events.
Target L-asparagine
Information of corresponding available drug in the market
Brand Name Elspar
Company Merck & Co. Inc
Brand Discription Elspar contains the enzyme L-asparagine amidohydrolase, type EC-2, derived from Escherichia coli. Elspar activity is expressed in terms of International Units according to the recommendation of the International Union of Biochemistry. One International Un
Prescribed for To treat acute lymphocytic leukemia. It is used along with other cancer medicines. Elspar is an antineoplastic agent that works by decreasing the amount of asparagine in the body, which kills certain leukemia cells
Chemical Name N.A.
Formulation Each vial contains 10,000 International Units of asparaginase and 80 mg of mannitol.
Physcial Appearance Lyophilized plug or powder
Route of Administration Intravenous or intramuSubcutaneousular. Intravenou
Recommended Dosage The recommended dose of Elspar is 6,000 International Units/m_ intramuscularly (IM) or intravenously (IV) three times a week.
Contraindication Allergic
Side Effects Fever, chills (see flu like symptoms), Nausea and vomiting, Allergic reaction, (sudden onset of wheezing, itching, rash, face swelling, agitation, low blood pressure). You will be monitored closely for this reaction, Poor appetite, Stomach cramping
Useful Link http://www.rxlist.com/elspar-drug.htm
PubMed ID 17554375, 14499708, 25098829, 24436152, 23794007, 22499236, 20824725
3-D Structure Th1020 (View) or (Download)

Entry 2
(2) Primary information
ID 1143
ThPP ID Th1020
Therapeutic Peptide/Protein Name Asparaginase
Sequence Elspar Sequence: QMSLQQELRYIEALSAIVETGQKMLEAGESALD view full sequnce in fasta
Functional Classification Ic
Molecular Weight 31731.9
Chemical Formula C1377H2208N382O442S17
Isoelectric Point 4.67
Hydrophobicity 0.059
Melting Point (℃) N.A.
Half Life 8-30 hours
Description L-asparagine amidohydrolase from E. coli
Indication/Disease To treat acute lympocytic leukemia and non-Hodgkins lymphoma
Pharmacodynamics In most patients with acute leukemia, the malignant cells are dependent on an exogenous source of asparagine for survival. Normal cells, however, are able to synthesize asparagine and thus are affected less by the rapid depletion produced by treatment with the enzyme asparaginase. Elspar exploits a metabolic defect in asparagine synthesis of some malignant cells.
Mechanism of Action Asparaginase converts asparagine to aspartic acid and ammonia. It facilitates production of oxalo-acetate which is needed for general cellular metabolism. Some malignant cells lose the ability to produce asparagine and thus the loss of exogenous sources of asparagine leads to cell death.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Antineoplastic Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Mouth sores, Pancreatitis (inflammation of the pancreas) in up to 10% of patients. Mainly noted in blood tests that return to normal after therapy is discontinued. Rarely may be severe causing symptoms. Symptoms of acute pancreatitis include: (pain in the upper abdomen that worsens with eating, swollen and tender abdomen, nausea, vomiting, fever, and rapid pulse).
Useful Link http://www.rxlist.com/elspar-drug/indications-dosage.htm
PubMed ID 17554375, 14499708, 25098829, 24436152, 23794007, 22499236, 20824725
3-D Structure Th1020 (View) or (Download)

Entry 3
(3) Primary information
ID 1144
ThPP ID Th1020
Therapeutic Peptide/Protein Name Asparaginase
Sequence Elspar Sequence: QMSLQQELRYIEALSAIVETGQKMLEAGESALD view full sequnce in fasta
Functional Classification Ic
Molecular Weight 31731.9
Chemical Formula C1377H2208N382O442S17
Isoelectric Point 4.67
Hydrophobicity 0.059
Melting Point (℃) N.A.
Half Life 8-30 hours
Description L-asparagine amidohydrolase from E. coli
Indication/Disease To treat acute lympocytic leukemia and non-Hodgkins lymphoma
Pharmacodynamics In most patients with acute leukemia, the malignant cells are dependent on an exogenous source of asparagine for survival. Normal cells, however, are able to synthesize asparagine and thus are affected less by the rapid depletion produced by treatment with the enzyme asparaginase. Elspar exploits a metabolic defect in asparagine synthesis of some malignant cells.
Mechanism of Action Asparaginase converts asparagine to aspartic acid and ammonia. It facilitates production of oxalo-acetate which is needed for general cellular metabolism. Some malignant cells lose the ability to produce asparagine and thus the loss of exogenous sources of asparagine leads to cell death.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Antineoplastic Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Central neurotoxicity: excessive sleepiness, depression, hallucinations, agitation, disorientation or seizure, stupor, confusion and/or coma.
Useful Link http://www.drugs.com/cdi/elspar.html
PubMed ID 17554375, 14499708, 25098829, 24436152, 23794007, 22499236, 20824725
3-D Structure Th1020 (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

(1) Primary information
Entry 1
ID	1142
ThPP ID	Th1020
Therapeutic Peptide/Protein Name	Asparaginase
Sequence	Elspar Sequence: QMSLQQELRYIEALSAIVETGQKMLEAGESALD view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	31731.9
Chemical Formula	C1377H2208N382O442S17
Isoelectric Point	4.67
Hydrophobicity	0.059
Melting Point (℃)	N.A.
Half Life	8-30 hours
Description	L-asparagine amidohydrolase from E. coli
Indication/Disease	To treat acute lympocytic leukemia and non-Hodgkins lymphoma
Pharmacodynamics	In most patients with acute leukemia, the malignant cells are dependent on an exogenous source of asparagine for survival. Normal cells, however, are able to synthesize asparagine and thus are affected less by the rapid depletion produced by treatment with the enzyme asparaginase. Elspar exploits a metabolic defect in asparagine synthesis of some malignant cells.
Mechanism of Action	Asparaginase converts asparagine to aspartic acid and ammonia. It facilitates production of oxalo-acetate which is needed for general cellular metabolism. Some malignant cells lose the ability to produce asparagine and thus the loss of exogenous sources of asparagine leads to cell death.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Antineoplastic Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Trastuzumab may increase the risk of neutropenia and anemia. Monitor closely for signs and symptoms of adverse events.
Target	L-asparagine
Information of corresponding available drug in the market
Brand Name	Elspar
Company	Merck & Co. Inc
Brand Discription	Elspar contains the enzyme L-asparagine amidohydrolase, type EC-2, derived from Escherichia coli. Elspar activity is expressed in terms of International Units according to the recommendation of the International Union of Biochemistry. One International Un
Prescribed for	To treat acute lymphocytic leukemia. It is used along with other cancer medicines. Elspar is an antineoplastic agent that works by decreasing the amount of asparagine in the body, which kills certain leukemia cells
Chemical Name	N.A.
Formulation	Each vial contains 10,000 International Units of asparaginase and 80 mg of mannitol.
Physcial Appearance	Lyophilized plug or powder
Route of Administration	Intravenous or intramuSubcutaneousular. Intravenou
Recommended Dosage	The recommended dose of Elspar is 6,000 International Units/m_ intramuscularly (IM) or intravenously (IV) three times a week.
Contraindication	Allergic
Side Effects	Fever, chills (see flu like symptoms), Nausea and vomiting, Allergic reaction, (sudden onset of wheezing, itching, rash, face swelling, agitation, low blood pressure). You will be monitored closely for this reaction, Poor appetite, Stomach cramping
Useful Link	http://www.rxlist.com/elspar-drug.htm
PubMed ID	17554375, 14499708, 25098829, 24436152, 23794007, 22499236, 20824725
3-D Structure	Th1020 (View) or (Download)

(2) Primary information
Entry 2
ID	1143
ThPP ID	Th1020
Therapeutic Peptide/Protein Name	Asparaginase
Sequence	Elspar Sequence: QMSLQQELRYIEALSAIVETGQKMLEAGESALD view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	31731.9
Chemical Formula	C1377H2208N382O442S17
Isoelectric Point	4.67
Hydrophobicity	0.059
Melting Point (℃)	N.A.
Half Life	8-30 hours
Description	L-asparagine amidohydrolase from E. coli
Indication/Disease	To treat acute lympocytic leukemia and non-Hodgkins lymphoma
Pharmacodynamics	In most patients with acute leukemia, the malignant cells are dependent on an exogenous source of asparagine for survival. Normal cells, however, are able to synthesize asparagine and thus are affected less by the rapid depletion produced by treatment with the enzyme asparaginase. Elspar exploits a metabolic defect in asparagine synthesis of some malignant cells.
Mechanism of Action	Asparaginase converts asparagine to aspartic acid and ammonia. It facilitates production of oxalo-acetate which is needed for general cellular metabolism. Some malignant cells lose the ability to produce asparagine and thus the loss of exogenous sources of asparagine leads to cell death.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Antineoplastic Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Mouth sores, Pancreatitis (inflammation of the pancreas) in up to 10% of patients. Mainly noted in blood tests that return to normal after therapy is discontinued. Rarely may be severe causing symptoms. Symptoms of acute pancreatitis include: (pain in the upper abdomen that worsens with eating, swollen and tender abdomen, nausea, vomiting, fever, and rapid pulse).
Useful Link	http://www.rxlist.com/elspar-drug/indications-dosage.htm
PubMed ID	17554375, 14499708, 25098829, 24436152, 23794007, 22499236, 20824725
3-D Structure	Th1020 (View) or (Download)

(3) Primary information
Entry 3
ID	1144
ThPP ID	Th1020
Therapeutic Peptide/Protein Name	Asparaginase
Sequence	Elspar Sequence: QMSLQQELRYIEALSAIVETGQKMLEAGESALD view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	31731.9
Chemical Formula	C1377H2208N382O442S17
Isoelectric Point	4.67
Hydrophobicity	0.059
Melting Point (℃)	N.A.
Half Life	8-30 hours
Description	L-asparagine amidohydrolase from E. coli
Indication/Disease	To treat acute lympocytic leukemia and non-Hodgkins lymphoma
Pharmacodynamics	In most patients with acute leukemia, the malignant cells are dependent on an exogenous source of asparagine for survival. Normal cells, however, are able to synthesize asparagine and thus are affected less by the rapid depletion produced by treatment with the enzyme asparaginase. Elspar exploits a metabolic defect in asparagine synthesis of some malignant cells.
Mechanism of Action	Asparaginase converts asparagine to aspartic acid and ammonia. It facilitates production of oxalo-acetate which is needed for general cellular metabolism. Some malignant cells lose the ability to produce asparagine and thus the loss of exogenous sources of asparagine leads to cell death.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Antineoplastic Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Central neurotoxicity: excessive sleepiness, depression, hallucinations, agitation, disorientation or seizure, stupor, confusion and/or coma.
Useful Link	http://www.drugs.com/cdi/elspar.html
PubMed ID	17554375, 14499708, 25098829, 24436152, 23794007, 22499236, 20824725
3-D Structure	Th1020 (View) or (Download)