==== Reference: Usmani SS, Bedi G, Samuel JS, Singh S, Kalra S, Kumar P, et al. (2017) THPdb: Database of FDA-approved peptide and protein therapeutics. PLoS ONE 12(7) e0181748.====

Detailed description page of THPdb


Details of Th1021 which contains 3 entries.


Entry 1
(1) Primary information
ID1145
ThPP IDTh1021
Therapeutic Peptide/Protein NameThyrotropin Alfa
SequenceAlpha chain:APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYP view full sequnce in fasta
Functional ClassificationIV
Molecular Weight22672.9
Chemical FormulaC975H1513N267O304S26
Isoelectric Point7.5
Hydrophobicity-0.33
Melting Point (℃)55
Half Life5 ± 10 hours
DescriptionThyrotropin alfa is a recombinant form of thyroid stimulating hormone used in performing certain tests in patients who have or have had thyroid cancer. It is also used along with a radioactive agent to destroy remaining thyroid tissue in certain patients.
Indication/DiseaseFor detection of residueal or recurrent thyroid cancer
PharmacodynamicsBinding of thyrotropin alfa to TSH receptors on normal thyroid epithelial cells or on well-differentiated thyroid cancer tissue stimulates iodine uptake and organification. Thyrogen is an exogenous source of human TSH that offers an additional diagnostic tool in the follow-up of patients with a history of well-differentiated thyroid cancer.
Mechanism of ActionBinding of thyrotropin Alfa to the thyrotropin receptors found on any residual thyroid cells or tissues stimulates radioactive iodine uptake for better radiodiagnostic imaging.
ToxicityN.A.
MetabolismN.A.
AbsorptionN.A.
Volume of DistributionN.A.
ClearanceThrough kidney and liver
CategoriesDiagnostic Agents
Patents NumberUS5840566
Date of Issue24/11/95
Date of Expiry24/11/15
Drug InteractionN.A.
TargetThyrotropin receptor
Information of corresponding available drug in the market
Brand NameThyrogen
CompanyGenzyme Inc
Brand DiscriptionTHYROGEN contains recombinant human thyroid stimulating hormone (TSH). Thyrotropin alfa is synthesized in a genetically modified Chinese hamster ovary cell line. Thyrotropin alfa is a heterodimeric glycoprotein comprised of two non-covalently linked subun
Prescribed forIt is used in performing certain tests in patients who have or have had thyroid cancer. It is also used along with a radioactive agent to destroy remaining thyroid tissue in certain patients who have had their thyroid gland removed because of thyroid canc
Chemical NameN.A.
FormulationEach vial of THYROGEN contains 1.1 mg thyrotropin alfa, 36 mg Mannitol, 5.1 mg Sodium Phosphate, and 2.4 mg Sodium Chloride.
Physcial AppearanceLyophilized powder
Route of AdministrationIntramuSubcutaneousular preferably the buttocks
Recommended DosageA 0.9 mg intramuscular injection to the buttock followed by a second 0.9 mg intramuscular injection to the buttock 24 hours later.
ContraindicationAllergic
Side EffectsRash; hives; itching; difficulty breathing; tightness in the chest
Useful Linkhttp://www.rxlist.com/thyrogen-drug.htm
PubMed ID23389953, 26622936, 24040896, 23406027, 23389953, 23014071, 22551128, 21607603, 21404570
3-D StructureTh1021 (View) or (Download)


Entry 2
(2) Primary information
ID1146
ThPP IDTh1021
Therapeutic Peptide/Protein NameThyrotropin Alfa
SequenceAlpha chain:APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYP view full sequnce in fasta
Functional ClassificationIV
Molecular Weight22672.9
Chemical FormulaC975H1513N267O304S26
Isoelectric Point7.5
Hydrophobicity-0.33
Melting Point (℃)55
Half Life5 ± 10 hours
DescriptionThyrotropin alfa is a recombinant form of thyroid stimulating hormone used in performing certain tests in patients who have or have had thyroid cancer. It is also used along with a radioactive agent to destroy remaining thyroid tissue in certain patients.
Indication/DiseaseFor detection of residueal or recurrent thyroid cancer
PharmacodynamicsBinding of thyrotropin alfa to TSH receptors on normal thyroid epithelial cells or on well-differentiated thyroid cancer tissue stimulates iodine uptake and organification. Thyrogen is an exogenous source of human TSH that offers an additional diagnostic tool in the follow-up of patients with a history of well-differentiated thyroid cancer.
Mechanism of ActionBinding of thyrotropin Alfa to the thyrotropin receptors found on any residual thyroid cells or tissues stimulates radioactive iodine uptake for better radiodiagnostic imaging.
ToxicityN.A.
MetabolismN.A.
AbsorptionN.A.
Volume of DistributionN.A.
ClearanceThrough kidney and liver
CategoriesDiagnostic Agents
Patents NumberN.A.
Date of IssueN.A.
Date of ExpiryN.A.
Drug InteractionN.A.
TargetN.A.
Information of corresponding available drug in the market
Brand NameN.A.
CompanyN.A.
Brand DiscriptionN.A.
Prescribed forN.A.
Chemical NameN.A.
FormulationN.A.
Physcial AppearanceN.A.
Route of AdministrationN.A.
Recommended DosageN.A.
ContraindicationN.A.
Side EffectsSwelling of the mouth, face, lips, or tongue; confusion; one-sided weakness
Useful Linkhttp://www.drugs.com/cdi/thyrogen.html
PubMed ID23389953, 26622936, 24040896, 23406027, 23389953, 23014071, 22551128, 21607603, 21404570
3-D StructureTh1021 (View) or (Download)


Entry 3
(3) Primary information
ID1147
ThPP IDTh1021
Therapeutic Peptide/Protein NameThyrotropin Alfa
SequenceAlpha chain:APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYP view full sequnce in fasta
Functional ClassificationIV
Molecular Weight22672.9
Chemical FormulaC975H1513N267O304S26
Isoelectric Point7.5
Hydrophobicity-0.33
Melting Point (℃)55
Half Life5 ± 10 hours
DescriptionThyrotropin alfa is a recombinant form of thyroid stimulating hormone used in performing certain tests in patients who have or have had thyroid cancer. It is also used along with a radioactive agent to destroy remaining thyroid tissue in certain patients.
Indication/DiseaseFor detection of residueal or recurrent thyroid cancer
PharmacodynamicsBinding of thyrotropin alfa to TSH receptors on normal thyroid epithelial cells or on well-differentiated thyroid cancer tissue stimulates iodine uptake and organification. Thyrogen is an exogenous source of human TSH that offers an additional diagnostic tool in the follow-up of patients with a history of well-differentiated thyroid cancer.
Mechanism of ActionBinding of thyrotropin Alfa to the thyrotropin receptors found on any residual thyroid cells or tissues stimulates radioactive iodine uptake for better radiodiagnostic imaging.
ToxicityN.A.
MetabolismN.A.
AbsorptionN.A.
Volume of DistributionN.A.
ClearanceThrough kidney and liver
CategoriesDiagnostic Agents
Patents NumberN.A.
Date of IssueN.A.
Date of ExpiryN.A.
Drug InteractionN.A.
TargetN.A.
Information of corresponding available drug in the market
Brand NameN.A.
CompanyN.A.
Brand DiscriptionN.A.
Prescribed forN.A.
Chemical NameN.A.
FormulationN.A.
Physcial AppearanceN.A.
Route of AdministrationN.A.
Recommended DosageN.A.
ContraindicationN.A.
Side EffectsSevere or persistent dizziness or headache; shortness of breath or other breathing problems; slurred speech; vision problems.
Useful Linkhttp://www.drugs.com/drug-interactions/thyrotropin-alpha,thyrogen-index.html
PubMed ID23389953, 26622936, 24040896, 23406027, 23389953, 23014071, 22551128, 21607603, 21404570
3-D StructureTh1021 (View) or (Download)