Entry 1 |
(1) Primary information |
---|
ID | 1145 |
ThPP ID | Th1021 |
Therapeutic Peptide/Protein Name | Thyrotropin Alfa |
Sequence | Alpha chain:APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYP view full sequnce in fasta |
Functional Classification | IV |
Molecular Weight | 22672.9 |
Chemical Formula | C975H1513N267O304S26 |
Isoelectric Point | 7.5 |
Hydrophobicity | -0.33 |
Melting Point (℃) | 55 |
Half Life | 5 ± 10 hours |
Description | Thyrotropin alfa is a recombinant form of thyroid stimulating hormone used in performing certain tests in patients who have or have had thyroid cancer. It is also used along with a radioactive agent to destroy remaining thyroid tissue in certain patients. |
Indication/Disease | For detection of residueal or recurrent thyroid cancer |
Pharmacodynamics | Binding of thyrotropin alfa to TSH receptors on normal thyroid epithelial cells or on well-differentiated thyroid cancer tissue stimulates iodine uptake and organification. Thyrogen is an exogenous source of human TSH that offers an additional diagnostic tool in the follow-up of patients with a history of well-differentiated thyroid cancer. |
Mechanism of Action | Binding of thyrotropin Alfa to the thyrotropin receptors found on any residual thyroid cells or tissues stimulates radioactive iodine uptake for better radiodiagnostic imaging. |
Toxicity | N.A. |
Metabolism | N.A. |
Absorption | N.A. |
Volume of Distribution | N.A. |
Clearance | Through kidney and liver |
Categories | Diagnostic Agents |
Patents Number | US5840566 |
Date of Issue | 24/11/95 |
Date of Expiry | 24/11/15 |
Drug Interaction | N.A. |
Target | Thyrotropin receptor |
Information of corresponding available drug in the market |
---|
Brand Name | Thyrogen |
Company | Genzyme Inc |
Brand Discription | THYROGEN contains recombinant human thyroid stimulating hormone (TSH). Thyrotropin alfa is synthesized in a genetically modified Chinese hamster ovary cell line. Thyrotropin alfa is a heterodimeric glycoprotein comprised of two non-covalently linked subun |
Prescribed for | It is used in performing certain tests in patients who have or have had thyroid cancer. It is also used along with a radioactive agent to destroy remaining thyroid tissue in certain patients who have had their thyroid gland removed because of thyroid canc |
Chemical Name | N.A. |
Formulation | Each vial of THYROGEN contains 1.1 mg thyrotropin alfa, 36 mg Mannitol, 5.1 mg Sodium Phosphate, and 2.4 mg Sodium Chloride. |
Physcial Appearance | Lyophilized powder |
Route of Administration | IntramuSubcutaneousular preferably the buttocks |
Recommended Dosage | A 0.9 mg intramuscular injection to the buttock followed by a second 0.9 mg intramuscular injection to the buttock 24 hours later. |
Contraindication | Allergic |
Side Effects | Rash; hives; itching; difficulty breathing; tightness in the chest |
Useful Link | http://www.rxlist.com/thyrogen-drug.htm |
PubMed ID | 23389953, 26622936, 24040896, 23406027, 23389953, 23014071, 22551128, 21607603, 21404570 |
3-D Structure | Th1021 (View) or (Download) |
Entry 2 |
(2) Primary information |
---|
ID | 1146 |
ThPP ID | Th1021 |
Therapeutic Peptide/Protein Name | Thyrotropin Alfa |
Sequence | Alpha chain:APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYP view full sequnce in fasta |
Functional Classification | IV |
Molecular Weight | 22672.9 |
Chemical Formula | C975H1513N267O304S26 |
Isoelectric Point | 7.5 |
Hydrophobicity | -0.33 |
Melting Point (℃) | 55 |
Half Life | 5 ± 10 hours |
Description | Thyrotropin alfa is a recombinant form of thyroid stimulating hormone used in performing certain tests in patients who have or have had thyroid cancer. It is also used along with a radioactive agent to destroy remaining thyroid tissue in certain patients. |
Indication/Disease | For detection of residueal or recurrent thyroid cancer |
Pharmacodynamics | Binding of thyrotropin alfa to TSH receptors on normal thyroid epithelial cells or on well-differentiated thyroid cancer tissue stimulates iodine uptake and organification. Thyrogen is an exogenous source of human TSH that offers an additional diagnostic tool in the follow-up of patients with a history of well-differentiated thyroid cancer. |
Mechanism of Action | Binding of thyrotropin Alfa to the thyrotropin receptors found on any residual thyroid cells or tissues stimulates radioactive iodine uptake for better radiodiagnostic imaging. |
Toxicity | N.A. |
Metabolism | N.A. |
Absorption | N.A. |
Volume of Distribution | N.A. |
Clearance | Through kidney and liver |
Categories | Diagnostic Agents |
Patents Number | N.A. |
Date of Issue | N.A. |
Date of Expiry | N.A. |
Drug Interaction | N.A. |
Target | N.A. |
Information of corresponding available drug in the market |
---|
Brand Name | N.A. |
Company | N.A. |
Brand Discription | N.A. |
Prescribed for | N.A. |
Chemical Name | N.A. |
Formulation | N.A. |
Physcial Appearance | N.A. |
Route of Administration | N.A. |
Recommended Dosage | N.A. |
Contraindication | N.A. |
Side Effects | Swelling of the mouth, face, lips, or tongue; confusion; one-sided weakness |
Useful Link | http://www.drugs.com/cdi/thyrogen.html |
PubMed ID | 23389953, 26622936, 24040896, 23406027, 23389953, 23014071, 22551128, 21607603, 21404570 |
3-D Structure | Th1021 (View) or (Download) |
Entry 3 |
(3) Primary information |
---|
ID | 1147 |
ThPP ID | Th1021 |
Therapeutic Peptide/Protein Name | Thyrotropin Alfa |
Sequence | Alpha chain:APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYP view full sequnce in fasta |
Functional Classification | IV |
Molecular Weight | 22672.9 |
Chemical Formula | C975H1513N267O304S26 |
Isoelectric Point | 7.5 |
Hydrophobicity | -0.33 |
Melting Point (℃) | 55 |
Half Life | 5 ± 10 hours |
Description | Thyrotropin alfa is a recombinant form of thyroid stimulating hormone used in performing certain tests in patients who have or have had thyroid cancer. It is also used along with a radioactive agent to destroy remaining thyroid tissue in certain patients. |
Indication/Disease | For detection of residueal or recurrent thyroid cancer |
Pharmacodynamics | Binding of thyrotropin alfa to TSH receptors on normal thyroid epithelial cells or on well-differentiated thyroid cancer tissue stimulates iodine uptake and organification. Thyrogen is an exogenous source of human TSH that offers an additional diagnostic tool in the follow-up of patients with a history of well-differentiated thyroid cancer. |
Mechanism of Action | Binding of thyrotropin Alfa to the thyrotropin receptors found on any residual thyroid cells or tissues stimulates radioactive iodine uptake for better radiodiagnostic imaging. |
Toxicity | N.A. |
Metabolism | N.A. |
Absorption | N.A. |
Volume of Distribution | N.A. |
Clearance | Through kidney and liver |
Categories | Diagnostic Agents |
Patents Number | N.A. |
Date of Issue | N.A. |
Date of Expiry | N.A. |
Drug Interaction | N.A. |
Target | N.A. |
Information of corresponding available drug in the market |
---|
Brand Name | N.A. |
Company | N.A. |
Brand Discription | N.A. |
Prescribed for | N.A. |
Chemical Name | N.A. |
Formulation | N.A. |
Physcial Appearance | N.A. |
Route of Administration | N.A. |
Recommended Dosage | N.A. |
Contraindication | N.A. |
Side Effects | Severe or persistent dizziness or headache; shortness of breath or other breathing problems; slurred speech; vision problems. |
Useful Link | http://www.drugs.com/drug-interactions/thyrotropin-alpha,thyrogen-index.html |
PubMed ID | 23389953, 26622936, 24040896, 23406027, 23389953, 23014071, 22551128, 21607603, 21404570 |
3-D Structure | Th1021 (View) or (Download) |