| Entry 1 |
| (1) Primary information |
|---|
| ID | 1148 |
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | CA2124690 |
| Date of Issue | 11/09/07 |
| Date of Expiry | 01/10/13 |
| Drug Interaction | N.A. |
| Target | Coagulation factor X,Coagulation factor IX,von Willebrand factor,Phytanoyl-CoA dioxygenase, peroxisomal,Asialoglycoprotein receptor 2,78 kDa glucose-regulated protein,Calreticulin,Calnexin,Protein ERGIC-53,Prolow-density lipoprotein receptor-related protein 1,Multiple coagulation factor deficiency protein 2 |
| Information of corresponding available drug in the market |
|---|
| Brand Name | Advate |
| Company | N.A. |
| Brand Discription | Advate contains antihemophilic factor, a naturally occurring protein in the blood that helps blood to clot. Advate works by temporarily raising levels of factor VIII in the blood to aid in clotting. |
| Prescribed for | ADVATE is a medicine used to replace clotting factor that is missing in people with hemophilia A. It is used to prevent and control bleeding in adults and children (0-16 years) with hemophilia A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | Powder form |
| Route of Administration | Intravenous Injection |
| Recommended Dosage | Dose (IU) = body weight (kg) _ Desired Factor VIII Rise (IU/dL or % of normal) _ 0.5 (IU/kg per IU/dL). So example, assuming assuming patient's baseline Factor VIII level is < 1% of normal = A dose of 1750 IU ADVATE administered to a 70 kg patient should be expected to result in a peak post-infusion Factor VIII increase of 1750 IU × {[2 IU/dL]/[IU/kg]}/[70 kg] = 50 IU/dL (50% of normal). |
| Contraindication | Patients who have life-threatening hypersensitivity reactions, including anaphylaxis, to mouse or hamster protein or other constituents of the product. |
| Side Effects | Chest pain; easy bruising, increased bleeding episodes; or bleeding from a wound or where the medicine was injected. |
| Useful Link | http://www.advate.com/assets/pdf/advate_iri_pi.pdf |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |
| Entry 2 |
| (2) Primary information |
|---|
| ID | 1149 |
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | CA1339477 |
| Date of Issue | 23/09/97 |
| Date of Expiry | 23/09/14 |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | Sore throat, cough, runny nose; fever or chills; mild nausea, vomiting; unusual or unpleasant taste in your mouth; skin itching or rash. |
| Useful Link | http://www.drugs.com/advate.html |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |
| Entry 3 |
| (3) Primary information |
|---|
| ID | 1150 |
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | Warmth, redness, itching, or tingling under your skin; joint pain or swelling; dizziness; headache; or swelling, stinging, or irritation where the injection was given. |
| Useful Link | http://www.baxter.com/healthcare_professionals/products/advate.html |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |
| Entry 4 |
| (4) Primary information |
|---|
| ID | 1151 |
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | Alphanate |
| Company | N.A. |
| Brand Discription | Alphanate(Solvent Detergent / Heat Treated) is a single dose, sterile, lyophilized concentrate of Factor VIII intended for intravenous administration in the treatment of hemophilia A, or acquired Factor VIII deficiency. Alphanate is prepared from pooled h |
| Prescribed for | It is used for preventing and controlling bleeding in adult patients with hemophilia A. It is also used to control certain types of bleeding episodes (eg, due to injury or surgery) in patients with von Willebrand disease. |
| Chemical Name | N.A. |
| Formulation | When reconstituted with the appropriate volume of Sterile Water for Injection, USP, Alphanate contains 0.3 - 0.9 g Albumin (Human)/100 mL; NMT 5 mmol calcium/L; NMT 750 µg glycine/IU FVIIIC; NMT 1.0 U heparin/mL; 10 - 40 mmol histidine/L; NMT 0.1 mg imida |
| Physcial Appearance | Lyophilized powder |
| Route of Administration | Intravenous Injection |
| Recommended Dosage | Bodyweight (in kg) X 0.50 lU/kg X Factor VIII Increase Desired (Percent) = Number of Factor VIII:C IU Required. |
| Contraindication | Contraindicated in patients who have manifested life-threatening immediate hypersensitivity reactions including anaphylaxis to any components of the product. |
| Side Effects | Rash; hives; itching; difficulty breathing; tightness in the chest; swelling of the mouth, face, lips, or tongue); back or stomach pain; calf pain, swelling, or tenderness; chest pain; coughing up blood; dark urine; fever or chills; new or worsening bruis |
| Useful Link | http://www.rxlist.com/alphanate-drug.htm |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |
| Entry 5 |
| (5) Primary information |
|---|
| ID | 1152 |
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | http://www.drugs.com/cdi/alphanate.html |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |
| Entry 6 |
| (6) Primary information |
|---|
| ID | 1153 |
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | Bioclate |
| Company | Baxter Healthcare Corporation, Hyland Division and Genetics Institute, Inc. |
| Brand Discription | Bioclate is a glycoprotein synthesized by a genetically engineered Chinese Hamster Ovary cell line. In culture the CHO cell line secretes recombinant antihemophilic factor into the cell culture medium. The rAHF is purified from the culture medium utilizin |
| Prescribed for | To treat or prevent bleeding episodes in adults and children with hemophilia A. It is also used to control bleeding related to surgery or dentistry in a person with hemophilia. |
| Chemical Name | N.A. |
| Formulation | Biocolate is available in single-dose bottles which contain nominally 250, 500 and 1000 International Units per bottle.When reconstituted with the appropriate volume of diluent, it contains the following stabilizers in maximum amounts: 12.5 mg/mL Albumin |
| Physcial Appearance | Sterile, nonpyrogenic, off-white to faint yellow, lyophilized powder |
| Route of Administration | Intravenous infusion |
| Recommended Dosage | N.A. |
| Contraindication | Allergic |
| Side Effects | Chest pain; easy bruising, increased bleeding episodes; or bleeding from a wound or where the medicine was injected. |
| Useful Link | http://www.drugs.com/mtm/bioclate-recombinant.html |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |
| Entry 7 |
| (7) Primary information |
|---|
| ID | 1154 |
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | Sore throat, cough, runny nose; fever or chills; mild nausea, vomiting; unusual or unpleasant taste in your mouth; headache; dizziness; skin itching or rash. |
| Useful Link | http://www.rxlist.com/bioclate-drug.htm |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |
| Entry 8 |
| (8) Primary information |
|---|
| ID | 1155 |
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | Warmth, redness, itching, or tingling under your skin; joint pain or swelling; dizziness; headache; or swelling, stinging, or irritation where the injection was given. |
| Useful Link | http://www.webmd.com/drugs/2/drug-18250/bioclate-intravenous/details |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |
| Entry 9 |
| (9) Primary information |
|---|
| ID | 1156 |
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | Helixate FS |
| Company | N.A. |
| Brand Discription | Helixate FS has been manufactured using recombinant DNA technology and is produced by Baby Hamster Kidney cells into which the human factor VIII gene has been introduced. The cell culture medium contains Human Plasma Protein Solution and recombinant insul |
| Prescribed for | To control and prevent bleeding episodes in adults and children (0-16 years) with hemophilia A and also for surgical prophylaxis in adults and children with hemophilia A. It is also used for routine prophylactic treatment to reduce the frequency of bleedi |
| Chemical Name | N.A. |
| Formulation | Helixate is formulated with sucrose (0.9–1.3%), glycine (21–25 mg/mL), and histidine (18–23 mM) as stabilizers in the final container. The final product also contains calcium chloride (2–3 mM), sodium (27–36 mEq/L), chloride (32–40 mEq/L), polysorbate 80 |
| Physcial Appearance | Sterile, stable, purified, nonpyrogenic, dried concentrate |
| Route of Administration | Intravenous Injection |
| Recommended Dosage | Dosage (units) = body weight (kg) _ desired factor VIII rise (IU/dL or % or normal) _ 0.5 (IU/kg per IU/dL) |
| Contraindication | Patients who have manifested life-threatening immediate hypersensitivity reactions, including anaphylaxis, to the product or its components, including mouse or hamster proteins. |
| Side Effects | Local injection site reactions |
| Useful Link | http://www.helixatefs.com/ |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |
| Entry 10 |
| (10) Primary information |
|---|
| ID | 1157 |
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | Dizziness, rash , unusual taste in the mouth , mild increase in blood pressure |
| Useful Link | http://www.drugs.com/pro/helixate-fs.html |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |
| Entry 11 |
| (11) Primary information |
|---|
| ID | 1158 |
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | Pruritus , depersonalization , nausea , and rhinitis. |
| Useful Link | http://www.rxlist.com/helixate-fs-drug.htm |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |
| Entry 12 |
| (12) Primary information |
|---|
| ID | 1159 |
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | Hemofil M |
| Company | N.A. |
| Brand Discription | Hemofil M is a human clotting factor derived from pooled human plasma. It works by increasing the amount of clotting factor VII in the blood, helping the blood form clots and stop bleeding |
| Prescribed for | Preventing and controlling bleeding in patients with hemophilia A, including in surgical settings. |
| Chemical Name | N.A. |
| Formulation | HEMOFIL is available as single dose bottles that contain nominally 250 (NDC 0944-2930-01), 500 (NDC 0944-2931-01), 1000 (NDC 0944-2932-01), and 1700 (NDC 0944-2933-01) IU per bottle. Each bottle is labeled with the potency in International Units, and is p |
| Physcial Appearance | Dry concentrate |
| Route of Administration | Intravenous Injection |
| Recommended Dosage | The expected in vivo peak AHF level, expressed as IU/dL of plasma or percent of normal, can be calculated by multiplying the dose administered per kg body weight (IU/kg) by two. |
| Contraindication | Allergic |
| Side Effects | Rash; hives; itching; difficulty breathing; flushing; tightness in the chest; swelling of the mouth, face, lips, or tongue; wheezing; chest pain; fainting; nausea; severe or persistent dizziness or light-headedness; shortness of breath. |
| Useful Link | http://www.drugs.com/cdi/hemofil-m.html |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |
| Entry 13 |
| (13) Primary information |
|---|
| ID | 1160 |
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | http://www.druglib.com/druginfo/hemofil-m/indications_dosage/ |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |
| Entry 14 |
| (14) Primary information |
|---|
| ID | 1161 |
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | Hyate:C |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | To treat and prevent serious bleeding episodes in patients with a bleeding problem called hemophilia A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | Powder |
| Route of Administration | Intravenous Injection |
| Recommended Dosage | N.A. |
| Contraindication | Allergic |
| Side Effects | Fever, changes in facial skin color, chills, fast or irregular breathing, nausea, puffiness or swelling of the eyelids or around the eyes, sensation of burning, warmth, heat, numbness, tightness, or tingling, skin rash, hives, or itching, tightness in the chest, troubled breathing, and unusual tiredness or weakness. |
| Useful Link | http://www.ncbi.nlm.nih.gov/pubmed/2499293 |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |
| Entry 15 |
| (15) Primary information |
|---|
| ID | 1162 |
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | http://www.drugs.com/cons/hyate-c.html |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |
| Entry 16 |
| (16) Primary information |
|---|
| ID | 1163 |
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | http://www.webmd.com/drugs/2/drug-75943/hyatec-intravenous/details#interactions |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |
| Entry 17 |
| (17) Primary information |
|---|
| ID | 1164 |
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | Koate-HP |
| Company | N.A. |
| Brand Discription | Koate-HP is a naturally occurring protein in the blood that helps to clot. A lack of antihemophilic factor VIII is the cause of hemophilia A. |
| Prescribed for | To control and prevent bleeding episodes in people with low levels of factor VIII. It is also used in these patients before surgery to prevent bleeding. People with low factor VIII levels are at risk for bleeding longer after an injury/surgery and for ble |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | Powder |
| Route of Administration | Intravenous Injection |
| Recommended Dosage | N.A. |
| Contraindication | Allergic |
| Side Effects | Nausea, stomach pain, low fever, loss of appetite, dark urine, clay-colored stools, jaundice (yellowing of the skin or eyes); fever, chills, runny nose, and drowsiness followed about 2 weeks later by a rash and joint pain; fast heart rate, chest pain, troubled breathing and unusual tiredness. |
| Useful Link | http://www.prescriptiondrugs.com/drugs/koate-hp |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |
| Entry 18 |
| (18) Primary information |
|---|
| ID | 1165 |
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | Unusual taste in your mouth; cough, runny or stuffy nose; mild itching; swelling in your hands, ankles, or feet; headache or dizziness; mild nausea, diarrhea, stomach pain; sweating; joint pain; or chills or flushing (warmth or tingly feeling). |
| Useful Link | http://www.drugs.com/mtm/koate-hp-injection.html |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |
| Entry 19 |
| (19) Primary information |
|---|
| ID | 1166 |
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | Kogenate FS |
| Company | N.A. |
| Brand Discription | Kogenate FS is a coagulation factor VIII produced by recombinant DNA technology. It is produced by Baby Hamster Kidney cells into which the human factor VIII gene has been introduced. The cell culture medium contains Human Plasma Protein Solution and reco |
| Prescribed for | Kogenate FS is used to treat or prevent bleeding episodes in adults and children with hemophilia A. It is also used to control bleeding related to surgery or dentistry in a person with hemophilia, and to prevent joint damage in people age 16 or older with |
| Chemical Name | N.A. |
| Formulation | Kogenate FS is formulated with Sucrose ( 0.9- 1.3%), glycine (210-25mg/ml), histidine (18-23 mmol/L) as stablizers and 27-36mEq/L sodium, 2.0-3.0 mmol/L calcium, 32-40 mEq/L chloride, 64-96 _g/mL polysorbate 80, 28 mg/vial sucrose and trace amounts of Imi |
| Physcial Appearance | Powder |
| Route of Administration | Intravenous Injection |
| Recommended Dosage | N.A. |
| Contraindication | Allergic |
| Side Effects | Chest pain; easy bruising, increased bleeding episodes; or bleeding from a wound or where the medicine was injected. |
| Useful Link | http://www.drugs.com/kogenate.html |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |
| Entry 20 |
| (20) Primary information |
|---|
| ID | 1167 |
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | Sore throat, cough, runny nose; fever or chills; mild nausea, vomiting; unusual or unpleasant taste in your mouth; skin itching or rash; warmth, redness, itching, or tingling under your skin; joint pain or swelling; dizziness; headache; or swelling, stinging, or irritation where the injection was given. |
| Useful Link | http://www.rxlist.com/kogenate-fs-drug.htm |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |
| Entry 21 |
| (21) Primary information |
|---|
| ID | 1168 |
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | http://www.kogenatefs.com/index.php/about-kogenate |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |
| Entry 22 |
| (22) Primary information |
|---|
| ID | 1169 |
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | Monarc-M |
| Company | N.A. |
| Brand Discription | It is antihyemophilic factor. |
| Prescribed for | To treat and prevent serious bleeding episodes in patients with hemophilia A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | Powder |
| Route of Administration | Intravenous Injection |
| Recommended Dosage | N.A. |
| Contraindication | Allergic |
| Side Effects | Blurred vision, flushing, headache, nausea, vomiting |
| Useful Link | http://www.drugs.com/cons/monarc-m.html |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |
| Entry 23 |
| (23) Primary information |
|---|
| ID | 1170 |
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | Allergic reactions like skin rash, itching or hives, swelling of the face, lips, or tongue, chest pain, fast, irregular heartbeat, feeling faint or lightheaded, falls, fever or chills, flu-like symptoms, numbness or tingling in hands or feet, pain, redness or swelling at the injection site, stomach pain, unusually weak or tired and yellowing of the eyes or skin. |
| Useful Link | http://www.cvs.com/drug/monarc-m |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |
| Entry 24 |
| (24) Primary information |
|---|
| ID | 1171 |
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | Monoclate-P |
| Company | N.A. |
| Brand Discription | Monoclate-P, Factor VIII:C Pasteurized, Monoclonal Antibody Purified, is a sterile, stable, lyophilized concentrate of Factor VIII:C with reduced amounts of VWF:Ag and purified of extraneous plasma-derived protein by use of affinity chromatography. A muri |
| Prescribed for | To control and prevent bleeding episodes in people with hemophilia A. It is also used in these patients before surgery to prevent bleeding. |
| Chemical Name | N.A. |
| Formulation | Each vial contains the labeled amount of antihemophilic factor (AHF) activity as expressed in terms of International Units (I.U.) of antihemophilic activity. One unit of antihemophilic activity is equivalent to that quantity of AHF present in one mL of no |
| Physcial Appearance | Lyophilized powder for solution |
| Route of Administration | Intravenous Injection |
| Recommended Dosage | The following formula provides a guide of dosage calculations for both adult and pediatric patients:Number of AHF I.U. Required = Body weight(in kg) x desired Factor VIII increase(% normal) x 0.5 |
| Contraindication | Hypersensitivity to mouse protein |
| Side Effects | Products of this type are known to cause allergic reactions, mild chills, nausea or stinging at the infusion site. In some cases, inhibitors of FVIII may occur. |
| Useful Link | http://www.abopharmaceuticals.com/ProductSheets/MonoclateP.pdf |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |
| Entry 25 |
| (25) Primary information |
|---|
| ID | 1172 |
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | http://www.drugs.com/pro/monoclate-p.html |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |
| Entry 26 |
| (26) Primary information |
|---|
| ID | 1173 |
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | http://www.rxlist.com/monoclate-p-drug.htm |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |
| Entry 27 |
| (27) Primary information |
|---|
| ID | 1174 |
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | ReFacto |
| Company | N.A. |
| Brand Discription | ReFacto Antihemophilic Factor (Recombinant) is a purified protein produced by recombinant DNA technology for use in therapy of factor VIII deficiency. ReFacto (antihemophilic factor) is a glycoprotein with an approximate molecular mass of 170 kDa consisti |
| Prescribed for | To control and prevent hemorrhagic episodes and for surgical prophylaxis in patients with hemophilia A. ReFacto is indicated for short-term routine prophylaxis to reduce the frequency of spontaneous bleeding episodes |
| Chemical Name | N.A. |
| Formulation | It is available in single-use vials containing the labeled amount of factor VIII activity. Each vial contains nominally 250, 500, 1000 or 2000 IU of ReFacto (antihemophilic factor) per vial. The formulated product is a clear colorless solution upon recons |
| Physcial Appearance | Lyophilized powder |
| Route of Administration | Intravenous Injection |
| Recommended Dosage | Required units = body weight (kg)x desired factor VIII rise (IU/dL or % of normal)x 0.5 (IU/kg per IU/dL) |
| Contraindication | Known hypersensitivity to mouse or hamster proteins |
| Side Effects | Chest pain; easy bruising, increased bleeding episodes; or bleeding from a wound or where the medicine was injected. |
| Useful Link | http://www.drugs.com/mtm/refacto-recombinant.html |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |
| Entry 28 |
| (28) Primary information |
|---|
| ID | 1175 |
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | Sore throat, cough, runny nose; fever or chills; mild nausea, vomiting; unusual or unpleasant taste in your mouth; skin itching or rash; warmth, redness, itching, or tingling under your skin; joint pain or swelling; dizziness; headache; or swelling, stinging, or irritation where the injection was given. |
| Useful Link | http://www.medicines.org.uk/emc/medicine/21767/SPC |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |
| Entry 29 |
| (29) Primary information |
|---|
| ID | 1176 |
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | http://www.rxlist.com/refacto-drug.htm |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |
| Entry 30 |
| (30) Primary information |
|---|
| ID | 1177 |
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | Xyntha |
| Company | N.A. |
| Brand Discription | Antihemophilic Factor (Recombinant), Plasma/Albumin-Free, the active ingredient in XYNTHA, is a recombinant coagulation factor VIII produced by recombinant DNA technology for use in therapy of factor VIII deficiency. The Antihemophilic Factor (Recombinant |
| Prescribed for | Xyntha is used to treat or prevent bleeding episodes in adults and children with hemophilia A. It is also used to control bleeding related to surgery or dentistry in a person with hemophilia A. |
| Chemical Name | N.A. |
| Formulation | Each single-use vial contains nominally 250, 500, 1000 or 2000 IU of XYNTHA (antihemophilic factor) . Upon reconstitution, the product is a clear to slightly opalescent, colorless solution that contains sodium chloride, sucrose, L-histidine, calcium chlor |
| Physcial Appearance | Sterile, nonpyrogenic, preservative-free, freeze-dried powder |
| Route of Administration | Intravenous Injection |
| Recommended Dosage | Required units = body weight (kg) x desired factor VIII rise (IU/dL or % of normal) x 0.5 (IU/kg per IU/dL) |
| Contraindication | N.A. |
| Side Effects | Chest pain; easy bruising, increased bleeding episodes; or bleeding from a wound or where the medicine was injected. |
| Useful Link | http://www.xyntha.com/ |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |
| Entry 31 |
| (31) Primary information |
|---|
| ID | 1178 |
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | Sore throat, cough, runny nose; fever or chills; mild nausea, vomiting; unusual or unpleasant taste in your mouth; skin itching or rash; warmth, redness, itching, or tingling under your skin; joint pain or swelling; dizziness; headache; or swelling, stinging, or irritation where the injection was given. |
| Useful Link | http://www.drugs.com/xyntha.html |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |
| Entry 32 |
| (32) Primary information |
|---|
| ID | 1179 |
| ThPP ID | Th1022 |
| Therapeutic Peptide/Protein Name | Antihemophilic Factor |
| Sequence | ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 264725.5 |
| Chemical Formula | C11794H18314N3220O3553S83 |
| Isoelectric Point | 6.97 |
| Hydrophobicity | -0.533 |
| Melting Point (℃) | N.A. |
| Half Life | 8.4-19.3 hours |
| Description | Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells. |
| Indication/Disease | For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency. |
| Pharmacodynamics | Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade. |
| Mechanism of Action | Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 4.1 mL/h/kg [Previously treated pediatric patients] |
| Categories | Coagulants and Thrombotic agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | http://www.rxlist.com/xyntha-drug.htm |
| PubMed ID | 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726 |
| 3-D Structure | Th1022 (View) or (Download) |