Detailed description page of THPdb

Details of Th1022 which contains 32 entries.

Entry 1
(1) Primary information
ID 1148
ThPP ID Th1022
Therapeutic Peptide/Protein Name Antihemophilic Factor
Sequence ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification Ia
Molecular Weight 264725.5
Chemical Formula C11794H18314N3220O3553S83
Isoelectric Point 6.97
Hydrophobicity -0.533
Melting Point (℃) N.A.
Half Life 8.4-19.3 hours
Description Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 4.1 mL/h/kg [Previously treated pediatric patients]
Categories Coagulants and Thrombotic agents
Patents Number CA2124690
Date of Issue 11/09/07
Date of Expiry 01/10/13
Drug Interaction N.A.
Target Coagulation factor X,Coagulation factor IX,von Willebrand factor,Phytanoyl-CoA dioxygenase, peroxisomal,Asialoglycoprotein receptor 2,78 kDa glucose-regulated protein,Calreticulin,Calnexin,Protein ERGIC-53,Prolow-density lipoprotein receptor-related protein 1,Multiple coagulation factor deficiency protein 2
Information of corresponding available drug in the market
Brand Name Advate
Company N.A.
Brand Discription Advate contains antihemophilic factor, a naturally occurring protein in the blood that helps blood to clot. Advate works by temporarily raising levels of factor VIII in the blood to aid in clotting.
Prescribed for ADVATE is a medicine used to replace clotting factor that is missing in people with hemophiliaÂ A. It is used to prevent and control bleeding in adults and children (0-16 years) with hemophiliaÂ A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance Powder form
Route of Administration Intravenous Injection
Recommended Dosage Dose (IU) = body weight (kg) _ Desired Factor VIII Rise (IU/dL or % of normal) _ 0.5 (IU/kg per IU/dL). So example, assuming assuming patient's baseline Factor VIII level is < 1% of normal = A dose of 1750 IU ADVATE administered to a 70 kg patient should be expected to result in a peak post-infusion Factor VIII increase of 1750 IU Ã— {[2 IU/dL]/[IU/kg]}/[70 kg] = 50 IU/dL (50% of normal).
Contraindication Patients who have life-threatening hypersensitivity reactions, including anaphylaxis, to mouse or hamster protein or other constituents of the product.
Side Effects Chest pain; easy bruising, increased bleeding episodes; or bleeding from a wound or where the medicine was injected.
Useful Link http://www.advate.com/assets/pdf/advate_iri_pi.pdf
PubMed ID 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure Th1022 (View) or (Download)

Entry 2
(2) Primary information
ID 1149
ThPP ID Th1022
Therapeutic Peptide/Protein Name Antihemophilic Factor
Sequence ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification Ia
Molecular Weight 264725.5
Chemical Formula C11794H18314N3220O3553S83
Isoelectric Point 6.97
Hydrophobicity -0.533
Melting Point (℃) N.A.
Half Life 8.4-19.3 hours
Description Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 4.1 mL/h/kg [Previously treated pediatric patients]
Categories Coagulants and Thrombotic agents
Patents Number CA1339477
Date of Issue 23/09/97
Date of Expiry 23/09/14
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Sore throat, cough, runny nose; fever or chills; mild nausea, vomiting; unusual or unpleasant taste in your mouth; skin itching or rash.
Useful Link http://www.drugs.com/advate.html
PubMed ID 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure Th1022 (View) or (Download)

Entry 3
(3) Primary information
ID 1150
ThPP ID Th1022
Therapeutic Peptide/Protein Name Antihemophilic Factor
Sequence ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification Ia
Molecular Weight 264725.5
Chemical Formula C11794H18314N3220O3553S83
Isoelectric Point 6.97
Hydrophobicity -0.533
Melting Point (℃) N.A.
Half Life 8.4-19.3 hours
Description Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 4.1 mL/h/kg [Previously treated pediatric patients]
Categories Coagulants and Thrombotic agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Warmth, redness, itching, or tingling under your skin; joint pain or swelling; dizziness; headache; or swelling, stinging, or irritation where the injection was given.
Useful Link http://www.baxter.com/healthcare_professionals/products/advate.html
PubMed ID 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure Th1022 (View) or (Download)

Entry 4
(4) Primary information
ID 1151
ThPP ID Th1022
Therapeutic Peptide/Protein Name Antihemophilic Factor
Sequence ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification Ia
Molecular Weight 264725.5
Chemical Formula C11794H18314N3220O3553S83
Isoelectric Point 6.97
Hydrophobicity -0.533
Melting Point (℃) N.A.
Half Life 8.4-19.3 hours
Description Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 4.1 mL/h/kg [Previously treated pediatric patients]
Categories Coagulants and Thrombotic agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name Alphanate
Company N.A.
Brand Discription Alphanate(Solvent Detergent / Heat Treated) is a single dose, sterile, lyophilized concentrate of Factor VIII intended for intravenous administration in the treatment of hemophilia A, or acquired Factor VIII deficiency. Alphanate is prepared from pooled h
Prescribed for It is used for preventing and controlling bleeding in adult patients with hemophilia A. It is also used to control certain types of bleeding episodes (eg, due to injury or surgery) in patients with von Willebrand disease.
Chemical Name N.A.
Formulation When reconstituted with the appropriate volume of Sterile Water for Injection, USP, Alphanate contains 0.3 - 0.9 g Albumin (Human)/100 mL; NMT 5 mmol calcium/L; NMT 750 Âµg glycine/IU FVIIIC; NMT 1.0 U heparin/mL; 10 - 40 mmol histidine/L; NMT 0.1 mg imida
Physcial Appearance Lyophilized powder
Route of Administration Intravenous Injection
Recommended Dosage Bodyweight (in kg) X 0.50 lU/kg X Factor VIII Increase Desired (Percent) = Number of Factor VIII:C IU Required.
Contraindication Contraindicated in patients who have manifested life-threatening immediate hypersensitivity reactions including anaphylaxis to any components of the product.
Side Effects Rash; hives; itching; difficulty breathing; tightness in the chest; swelling of the mouth, face, lips, or tongue); back or stomach pain; calf pain, swelling, or tenderness; chest pain; coughing up blood; dark urine; fever or chills; new or worsening bruis
Useful Link http://www.rxlist.com/alphanate-drug.htm
PubMed ID 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure Th1022 (View) or (Download)

Entry 5
(5) Primary information
ID 1152
ThPP ID Th1022
Therapeutic Peptide/Protein Name Antihemophilic Factor
Sequence ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification Ia
Molecular Weight 264725.5
Chemical Formula C11794H18314N3220O3553S83
Isoelectric Point 6.97
Hydrophobicity -0.533
Melting Point (℃) N.A.
Half Life 8.4-19.3 hours
Description Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 4.1 mL/h/kg [Previously treated pediatric patients]
Categories Coagulants and Thrombotic agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.drugs.com/cdi/alphanate.html
PubMed ID 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure Th1022 (View) or (Download)

Entry 6
(6) Primary information
ID 1153
ThPP ID Th1022
Therapeutic Peptide/Protein Name Antihemophilic Factor
Sequence ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification Ia
Molecular Weight 264725.5
Chemical Formula C11794H18314N3220O3553S83
Isoelectric Point 6.97
Hydrophobicity -0.533
Melting Point (℃) N.A.
Half Life 8.4-19.3 hours
Description Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 4.1 mL/h/kg [Previously treated pediatric patients]
Categories Coagulants and Thrombotic agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name Bioclate
Company Baxter Healthcare Corporation, Hyland Division and Genetics Institute, Inc.
Brand Discription Bioclate is a glycoprotein synthesized by a genetically engineered Chinese Hamster Ovary cell line. In culture the CHO cell line secretes recombinant antihemophilic factor into the cell culture medium. The rAHF is purified from the culture medium utilizin
Prescribed for To treat or prevent bleeding episodes in adults and children with hemophilia A. It is also used to control bleeding related to surgery or dentistry in a person with hemophilia.
Chemical Name N.A.
Formulation Biocolate is available in single-dose bottles which contain nominally 250, 500 and 1000 International Units per bottle.When reconstituted with the appropriate volume of diluent, it contains the following stabilizers in maximum amounts: 12.5 mg/mL Albumin
Physcial Appearance Sterile, nonpyrogenic, off-white to faint yellow, lyophilized powder
Route of Administration Intravenous infusion
Recommended Dosage N.A.
Contraindication Allergic
Side Effects Chest pain; easy bruising, increased bleeding episodes; or bleeding from a wound or where the medicine was injected.
Useful Link http://www.drugs.com/mtm/bioclate-recombinant.html
PubMed ID 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure Th1022 (View) or (Download)

Entry 7
(7) Primary information
ID 1154
ThPP ID Th1022
Therapeutic Peptide/Protein Name Antihemophilic Factor
Sequence ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification Ia
Molecular Weight 264725.5
Chemical Formula C11794H18314N3220O3553S83
Isoelectric Point 6.97
Hydrophobicity -0.533
Melting Point (℃) N.A.
Half Life 8.4-19.3 hours
Description Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 4.1 mL/h/kg [Previously treated pediatric patients]
Categories Coagulants and Thrombotic agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Sore throat, cough, runny nose; fever or chills; mild nausea, vomiting; unusual or unpleasant taste in your mouth; headache; dizziness; skin itching or rash.
Useful Link http://www.rxlist.com/bioclate-drug.htm
PubMed ID 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure Th1022 (View) or (Download)

Entry 8
(8) Primary information
ID 1155
ThPP ID Th1022
Therapeutic Peptide/Protein Name Antihemophilic Factor
Sequence ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification Ia
Molecular Weight 264725.5
Chemical Formula C11794H18314N3220O3553S83
Isoelectric Point 6.97
Hydrophobicity -0.533
Melting Point (℃) N.A.
Half Life 8.4-19.3 hours
Description Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 4.1 mL/h/kg [Previously treated pediatric patients]
Categories Coagulants and Thrombotic agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Warmth, redness, itching, or tingling under your skin; joint pain or swelling; dizziness; headache; or swelling, stinging, or irritation where the injection was given.
Useful Link http://www.webmd.com/drugs/2/drug-18250/bioclate-intravenous/details
PubMed ID 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure Th1022 (View) or (Download)

Entry 9
(9) Primary information
ID 1156
ThPP ID Th1022
Therapeutic Peptide/Protein Name Antihemophilic Factor
Sequence ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification Ia
Molecular Weight 264725.5
Chemical Formula C11794H18314N3220O3553S83
Isoelectric Point 6.97
Hydrophobicity -0.533
Melting Point (℃) N.A.
Half Life 8.4-19.3 hours
Description Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 4.1 mL/h/kg [Previously treated pediatric patients]
Categories Coagulants and Thrombotic agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name Helixate FS
Company N.A.
Brand Discription Helixate FS has been manufactured using recombinant DNA technology and is produced by Baby Hamster Kidney cells into which the human factor VIII gene has been introduced. The cell culture medium contains Human Plasma Protein Solution and recombinant insul
Prescribed for To control and prevent bleeding episodes in adults and children (0-16 years) with hemophilia A and also for surgical prophylaxis in adults and children with hemophilia A. It is also used for routine prophylactic treatment to reduce the frequency of bleedi
Chemical Name N.A.
Formulation Helixate is formulated with sucrose (0.9â€“1.3%), glycine (21â€“25 mg/mL), and histidine (18â€“23 mM) as stabilizers in the final container. The final product also contains calcium chloride (2â€“3 mM), sodium (27â€“36 mEq/L), chloride (32â€“40 mEq/L), polysorbate 80
Physcial Appearance Sterile, stable, purified, nonpyrogenic, dried concentrate
Route of Administration Intravenous Injection
Recommended Dosage Dosage (units) = body weight (kg) _ desired factor VIII rise (IU/dL or % or normal) _ 0.5 (IU/kg per IU/dL)
Contraindication Patients who have manifested life-threatening immediate hypersensitivity reactions, including anaphylaxis, to the product or its components, including mouse or hamster proteins.
Side Effects Local injection site reactions
Useful Link http://www.helixatefs.com/
PubMed ID 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure Th1022 (View) or (Download)

Entry 10
(10) Primary information
ID 1157
ThPP ID Th1022
Therapeutic Peptide/Protein Name Antihemophilic Factor
Sequence ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification Ia
Molecular Weight 264725.5
Chemical Formula C11794H18314N3220O3553S83
Isoelectric Point 6.97
Hydrophobicity -0.533
Melting Point (℃) N.A.
Half Life 8.4-19.3 hours
Description Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 4.1 mL/h/kg [Previously treated pediatric patients]
Categories Coagulants and Thrombotic agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Dizziness, rash , unusual taste in the mouth , mild increase in blood pressure
Useful Link http://www.drugs.com/pro/helixate-fs.html
PubMed ID 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure Th1022 (View) or (Download)

Entry 11
(11) Primary information
ID 1158
ThPP ID Th1022
Therapeutic Peptide/Protein Name Antihemophilic Factor
Sequence ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification Ia
Molecular Weight 264725.5
Chemical Formula C11794H18314N3220O3553S83
Isoelectric Point 6.97
Hydrophobicity -0.533
Melting Point (℃) N.A.
Half Life 8.4-19.3 hours
Description Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 4.1 mL/h/kg [Previously treated pediatric patients]
Categories Coagulants and Thrombotic agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Pruritus , depersonalization , nausea , and rhinitis.
Useful Link http://www.rxlist.com/helixate-fs-drug.htm
PubMed ID 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure Th1022 (View) or (Download)

Entry 12
(12) Primary information
ID 1159
ThPP ID Th1022
Therapeutic Peptide/Protein Name Antihemophilic Factor
Sequence ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification Ia
Molecular Weight 264725.5
Chemical Formula C11794H18314N3220O3553S83
Isoelectric Point 6.97
Hydrophobicity -0.533
Melting Point (℃) N.A.
Half Life 8.4-19.3 hours
Description Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 4.1 mL/h/kg [Previously treated pediatric patients]
Categories Coagulants and Thrombotic agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name Hemofil M
Company N.A.
Brand Discription Hemofil M is a human clotting factor derived from pooled human plasma. It works by increasing the amount of clotting factor VII in the blood, helping the blood form clots and stop bleeding
Prescribed for Preventing and controlling bleeding in patients with hemophilia A, including in surgical settings.
Chemical Name N.A.
Formulation HEMOFIL is available as single dose bottles that contain nominally 250 (NDC 0944-2930-01), 500 (NDC 0944-2931-01), 1000 (NDC 0944-2932-01), and 1700 (NDC 0944-2933-01) IU per bottle. Each bottle is labeled with the potency in International Units, and is p
Physcial Appearance Dry concentrate
Route of Administration Intravenous Injection
Recommended Dosage The expected in vivo peak AHF level, expressed as IU/dL of plasma or percent of normal, can be calculated by multiplying the dose administered per kg body weight (IU/kg) by two.
Contraindication Allergic
Side Effects Rash; hives; itching; difficulty breathing; flushing; tightness in the chest; swelling of the mouth, face, lips, or tongue; wheezing; chest pain; fainting; nausea; severe or persistent dizziness or light-headedness; shortness of breath.
Useful Link http://www.drugs.com/cdi/hemofil-m.html
PubMed ID 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure Th1022 (View) or (Download)

Entry 13
(13) Primary information
ID 1160
ThPP ID Th1022
Therapeutic Peptide/Protein Name Antihemophilic Factor
Sequence ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification Ia
Molecular Weight 264725.5
Chemical Formula C11794H18314N3220O3553S83
Isoelectric Point 6.97
Hydrophobicity -0.533
Melting Point (℃) N.A.
Half Life 8.4-19.3 hours
Description Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 4.1 mL/h/kg [Previously treated pediatric patients]
Categories Coagulants and Thrombotic agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.druglib.com/druginfo/hemofil-m/indications_dosage/
PubMed ID 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure Th1022 (View) or (Download)

Entry 14
(14) Primary information
ID 1161
ThPP ID Th1022
Therapeutic Peptide/Protein Name Antihemophilic Factor
Sequence ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification Ia
Molecular Weight 264725.5
Chemical Formula C11794H18314N3220O3553S83
Isoelectric Point 6.97
Hydrophobicity -0.533
Melting Point (℃) N.A.
Half Life 8.4-19.3 hours
Description Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 4.1 mL/h/kg [Previously treated pediatric patients]
Categories Coagulants and Thrombotic agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name Hyate:C
Company N.A.
Brand Discription N.A.
Prescribed for To treat and prevent serious bleeding episodes in patients with a bleeding problem called hemophilia A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance Powder
Route of Administration Intravenous Injection
Recommended Dosage N.A.
Contraindication Allergic
Side Effects Fever, changes in facial skin color, chills, fast or irregular breathing, nausea, puffiness or swelling of the eyelids or around the eyes, sensation of burning, warmth, heat, numbness, tightness, or tingling, skin rash, hives, or itching, tightness in the chest, troubled breathing, and unusual tiredness or weakness.
Useful Link http://www.ncbi.nlm.nih.gov/pubmed/2499293
PubMed ID 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure Th1022 (View) or (Download)

Entry 15
(15) Primary information
ID 1162
ThPP ID Th1022
Therapeutic Peptide/Protein Name Antihemophilic Factor
Sequence ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification Ia
Molecular Weight 264725.5
Chemical Formula C11794H18314N3220O3553S83
Isoelectric Point 6.97
Hydrophobicity -0.533
Melting Point (℃) N.A.
Half Life 8.4-19.3 hours
Description Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 4.1 mL/h/kg [Previously treated pediatric patients]
Categories Coagulants and Thrombotic agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.drugs.com/cons/hyate-c.html
PubMed ID 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure Th1022 (View) or (Download)

Entry 16
(16) Primary information
ID 1163
ThPP ID Th1022
Therapeutic Peptide/Protein Name Antihemophilic Factor
Sequence ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification Ia
Molecular Weight 264725.5
Chemical Formula C11794H18314N3220O3553S83
Isoelectric Point 6.97
Hydrophobicity -0.533
Melting Point (℃) N.A.
Half Life 8.4-19.3 hours
Description Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 4.1 mL/h/kg [Previously treated pediatric patients]
Categories Coagulants and Thrombotic agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.webmd.com/drugs/2/drug-75943/hyatec-intravenous/details#interactions
PubMed ID 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure Th1022 (View) or (Download)

Entry 17
(17) Primary information
ID 1164
ThPP ID Th1022
Therapeutic Peptide/Protein Name Antihemophilic Factor
Sequence ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification Ia
Molecular Weight 264725.5
Chemical Formula C11794H18314N3220O3553S83
Isoelectric Point 6.97
Hydrophobicity -0.533
Melting Point (℃) N.A.
Half Life 8.4-19.3 hours
Description Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 4.1 mL/h/kg [Previously treated pediatric patients]
Categories Coagulants and Thrombotic agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name Koate-HP
Company N.A.
Brand Discription Koate-HP is a naturally occurring protein in the blood that helps to clot. A lack of antihemophilic factor VIII is the cause of hemophilia A.
Prescribed for To control and prevent bleeding episodes in people with low levels of factor VIII. It is also used in these patients before surgery to prevent bleeding. People with low factor VIII levels are at risk for bleeding longer after an injury/surgery and for ble
Chemical Name N.A.
Formulation N.A.
Physcial Appearance Powder
Route of Administration Intravenous Injection
Recommended Dosage N.A.
Contraindication Allergic
Side Effects Nausea, stomach pain, low fever, loss of appetite, dark urine, clay-colored stools, jaundice (yellowing of the skin or eyes); fever, chills, runny nose, and drowsiness followed about 2 weeks later by a rash and joint pain; fast heart rate, chest pain, troubled breathing and unusual tiredness.
Useful Link http://www.prescriptiondrugs.com/drugs/koate-hp
PubMed ID 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure Th1022 (View) or (Download)

Entry 18
(18) Primary information
ID 1165
ThPP ID Th1022
Therapeutic Peptide/Protein Name Antihemophilic Factor
Sequence ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification Ia
Molecular Weight 264725.5
Chemical Formula C11794H18314N3220O3553S83
Isoelectric Point 6.97
Hydrophobicity -0.533
Melting Point (℃) N.A.
Half Life 8.4-19.3 hours
Description Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 4.1 mL/h/kg [Previously treated pediatric patients]
Categories Coagulants and Thrombotic agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Unusual taste in your mouth; cough, runny or stuffy nose; mild itching; swelling in your hands, ankles, or feet; headache or dizziness; mild nausea, diarrhea, stomach pain; sweating; joint pain; or chills or flushing (warmth or tingly feeling).
Useful Link http://www.drugs.com/mtm/koate-hp-injection.html
PubMed ID 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure Th1022 (View) or (Download)

Entry 19
(19) Primary information
ID 1166
ThPP ID Th1022
Therapeutic Peptide/Protein Name Antihemophilic Factor
Sequence ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification Ia
Molecular Weight 264725.5
Chemical Formula C11794H18314N3220O3553S83
Isoelectric Point 6.97
Hydrophobicity -0.533
Melting Point (℃) N.A.
Half Life 8.4-19.3 hours
Description Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 4.1 mL/h/kg [Previously treated pediatric patients]
Categories Coagulants and Thrombotic agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name Kogenate FS
Company N.A.
Brand Discription Kogenate FS is a coagulation factor VIII produced by recombinant DNA technology. It is produced by Baby Hamster Kidney cells into which the human factor VIII gene has been introduced. The cell culture medium contains Human Plasma Protein Solution and reco
Prescribed for Kogenate FS is used to treat or prevent bleeding episodes in adults and children with hemophilia A. It is also used to control bleeding related to surgery or dentistry in a person with hemophilia, and to prevent joint damage in people age 16 or older with
Chemical Name N.A.
Formulation Kogenate FS is formulated with Sucrose ( 0.9- 1.3%), glycine (210-25mg/ml), histidine (18-23 mmol/L) as stablizers and 27-36mEq/L sodium, 2.0-3.0 mmol/L calcium, 32-40 mEq/L chloride, 64-96 _g/mL polysorbate 80, 28 mg/vial sucrose and trace amounts of Imi
Physcial Appearance Powder
Route of Administration Intravenous Injection
Recommended Dosage N.A.
Contraindication Allergic
Side Effects Chest pain; easy bruising, increased bleeding episodes; or bleeding from a wound or where the medicine was injected.
Useful Link http://www.drugs.com/kogenate.html
PubMed ID 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure Th1022 (View) or (Download)

Entry 20
(20) Primary information
ID 1167
ThPP ID Th1022
Therapeutic Peptide/Protein Name Antihemophilic Factor
Sequence ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification Ia
Molecular Weight 264725.5
Chemical Formula C11794H18314N3220O3553S83
Isoelectric Point 6.97
Hydrophobicity -0.533
Melting Point (℃) N.A.
Half Life 8.4-19.3 hours
Description Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 4.1 mL/h/kg [Previously treated pediatric patients]
Categories Coagulants and Thrombotic agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Sore throat, cough, runny nose; fever or chills; mild nausea, vomiting; unusual or unpleasant taste in your mouth; skin itching or rash; warmth, redness, itching, or tingling under your skin; joint pain or swelling; dizziness; headache; or swelling, stinging, or irritation where the injection was given.
Useful Link http://www.rxlist.com/kogenate-fs-drug.htm
PubMed ID 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure Th1022 (View) or (Download)

Entry 21
(21) Primary information
ID 1168
ThPP ID Th1022
Therapeutic Peptide/Protein Name Antihemophilic Factor
Sequence ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification Ia
Molecular Weight 264725.5
Chemical Formula C11794H18314N3220O3553S83
Isoelectric Point 6.97
Hydrophobicity -0.533
Melting Point (℃) N.A.
Half Life 8.4-19.3 hours
Description Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 4.1 mL/h/kg [Previously treated pediatric patients]
Categories Coagulants and Thrombotic agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.kogenatefs.com/index.php/about-kogenate
PubMed ID 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure Th1022 (View) or (Download)

Entry 22
(22) Primary information
ID 1169
ThPP ID Th1022
Therapeutic Peptide/Protein Name Antihemophilic Factor
Sequence ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification Ia
Molecular Weight 264725.5
Chemical Formula C11794H18314N3220O3553S83
Isoelectric Point 6.97
Hydrophobicity -0.533
Melting Point (℃) N.A.
Half Life 8.4-19.3 hours
Description Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 4.1 mL/h/kg [Previously treated pediatric patients]
Categories Coagulants and Thrombotic agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name Monarc-M
Company N.A.
Brand Discription It is antihyemophilic factor.
Prescribed for To treat and prevent serious bleeding episodes in patients with hemophilia A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance Powder
Route of Administration Intravenous Injection
Recommended Dosage N.A.
Contraindication Allergic
Side Effects Blurred vision, flushing, headache, nausea, vomiting
Useful Link http://www.drugs.com/cons/monarc-m.html
PubMed ID 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure Th1022 (View) or (Download)

Entry 23
(23) Primary information
ID 1170
ThPP ID Th1022
Therapeutic Peptide/Protein Name Antihemophilic Factor
Sequence ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification Ia
Molecular Weight 264725.5
Chemical Formula C11794H18314N3220O3553S83
Isoelectric Point 6.97
Hydrophobicity -0.533
Melting Point (℃) N.A.
Half Life 8.4-19.3 hours
Description Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 4.1 mL/h/kg [Previously treated pediatric patients]
Categories Coagulants and Thrombotic agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Allergic reactions like skin rash, itching or hives, swelling of the face, lips, or tongue, chest pain, fast, irregular heartbeat, feeling faint or lightheaded, falls, fever or chills, flu-like symptoms, numbness or tingling in hands or feet, pain, redness or swelling at the injection site, stomach pain, unusually weak or tired and yellowing of the eyes or skin.
Useful Link http://www.cvs.com/drug/monarc-m
PubMed ID 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure Th1022 (View) or (Download)

Entry 24
(24) Primary information
ID 1171
ThPP ID Th1022
Therapeutic Peptide/Protein Name Antihemophilic Factor
Sequence ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification Ia
Molecular Weight 264725.5
Chemical Formula C11794H18314N3220O3553S83
Isoelectric Point 6.97
Hydrophobicity -0.533
Melting Point (℃) N.A.
Half Life 8.4-19.3 hours
Description Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 4.1 mL/h/kg [Previously treated pediatric patients]
Categories Coagulants and Thrombotic agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name Monoclate-P
Company N.A.
Brand Discription Monoclate-P, Factor VIII:C Pasteurized, Monoclonal Antibody Purified, is a sterile, stable, lyophilized concentrate of Factor VIII:C with reduced amounts of VWF:Ag and purified of extraneous plasma-derived protein by use of affinity chromatography. A muri
Prescribed for To control and prevent bleeding episodes in people with hemophilia A. It is also used in these patients before surgery to prevent bleeding.
Chemical Name N.A.
Formulation Each vial contains the labeled amount of antihemophilic factor (AHF) activity as expressed in terms of International Units (I.U.) of antihemophilic activity. One unit of antihemophilic activity is equivalent to that quantity of AHF present in one mL of no
Physcial Appearance Lyophilized powder for solution
Route of Administration Intravenous Injection
Recommended Dosage The following formula provides a guide of dosage calculations for both adult and pediatric patients:Number of AHF I.U. Required = Body weight(in kg) x desired Factor VIII increase(% normal) x 0.5
Contraindication Hypersensitivity to mouse protein
Side Effects Products of this type are known to cause allergic reactions, mild chills, nausea or stinging at the infusion site. In some cases, inhibitors of FVIII may occur.
Useful Link http://www.abopharmaceuticals.com/ProductSheets/MonoclateP.pdf
PubMed ID 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure Th1022 (View) or (Download)

Entry 25
(25) Primary information
ID 1172
ThPP ID Th1022
Therapeutic Peptide/Protein Name Antihemophilic Factor
Sequence ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification Ia
Molecular Weight 264725.5
Chemical Formula C11794H18314N3220O3553S83
Isoelectric Point 6.97
Hydrophobicity -0.533
Melting Point (℃) N.A.
Half Life 8.4-19.3 hours
Description Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 4.1 mL/h/kg [Previously treated pediatric patients]
Categories Coagulants and Thrombotic agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.drugs.com/pro/monoclate-p.html
PubMed ID 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure Th1022 (View) or (Download)

Entry 26
(26) Primary information
ID 1173
ThPP ID Th1022
Therapeutic Peptide/Protein Name Antihemophilic Factor
Sequence ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification Ia
Molecular Weight 264725.5
Chemical Formula C11794H18314N3220O3553S83
Isoelectric Point 6.97
Hydrophobicity -0.533
Melting Point (℃) N.A.
Half Life 8.4-19.3 hours
Description Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 4.1 mL/h/kg [Previously treated pediatric patients]
Categories Coagulants and Thrombotic agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.rxlist.com/monoclate-p-drug.htm
PubMed ID 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure Th1022 (View) or (Download)

Entry 27
(27) Primary information
ID 1174
ThPP ID Th1022
Therapeutic Peptide/Protein Name Antihemophilic Factor
Sequence ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification Ia
Molecular Weight 264725.5
Chemical Formula C11794H18314N3220O3553S83
Isoelectric Point 6.97
Hydrophobicity -0.533
Melting Point (℃) N.A.
Half Life 8.4-19.3 hours
Description Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 4.1 mL/h/kg [Previously treated pediatric patients]
Categories Coagulants and Thrombotic agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name ReFacto
Company N.A.
Brand Discription ReFacto Antihemophilic Factor (Recombinant) is a purified protein produced by recombinant DNA technology for use in therapy of factor VIII deficiency. ReFacto (antihemophilic factor) is a glycoprotein with an approximate molecular mass of 170 kDa consisti
Prescribed for To control and prevent hemorrhagic episodes and for surgical prophylaxis in patients with hemophilia A. ReFacto is indicated for short-term routine prophylaxis to reduce the frequency of spontaneous bleeding episodes
Chemical Name N.A.
Formulation It is available in single-use vials containing the labeled amount of factor VIII activity. Each vial contains nominally 250, 500, 1000 or 2000 IU of ReFacto (antihemophilic factor) per vial. The formulated product is a clear colorless solution upon recons
Physcial Appearance Lyophilized powder
Route of Administration Intravenous Injection
Recommended Dosage Required units = body weight (kg)x desired factor VIII rise (IU/dL or % of normal)x 0.5 (IU/kg per IU/dL)
Contraindication Known hypersensitivity to mouse or hamster proteins
Side Effects Chest pain; easy bruising, increased bleeding episodes; or bleeding from a wound or where the medicine was injected.
Useful Link http://www.drugs.com/mtm/refacto-recombinant.html
PubMed ID 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure Th1022 (View) or (Download)

Entry 28
(28) Primary information
ID 1175
ThPP ID Th1022
Therapeutic Peptide/Protein Name Antihemophilic Factor
Sequence ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification Ia
Molecular Weight 264725.5
Chemical Formula C11794H18314N3220O3553S83
Isoelectric Point 6.97
Hydrophobicity -0.533
Melting Point (℃) N.A.
Half Life 8.4-19.3 hours
Description Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 4.1 mL/h/kg [Previously treated pediatric patients]
Categories Coagulants and Thrombotic agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Sore throat, cough, runny nose; fever or chills; mild nausea, vomiting; unusual or unpleasant taste in your mouth; skin itching or rash; warmth, redness, itching, or tingling under your skin; joint pain or swelling; dizziness; headache; or swelling, stinging, or irritation where the injection was given.
Useful Link http://www.medicines.org.uk/emc/medicine/21767/SPC
PubMed ID 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure Th1022 (View) or (Download)

Entry 29
(29) Primary information
ID 1176
ThPP ID Th1022
Therapeutic Peptide/Protein Name Antihemophilic Factor
Sequence ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification Ia
Molecular Weight 264725.5
Chemical Formula C11794H18314N3220O3553S83
Isoelectric Point 6.97
Hydrophobicity -0.533
Melting Point (℃) N.A.
Half Life 8.4-19.3 hours
Description Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 4.1 mL/h/kg [Previously treated pediatric patients]
Categories Coagulants and Thrombotic agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.rxlist.com/refacto-drug.htm
PubMed ID 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure Th1022 (View) or (Download)

Entry 30
(30) Primary information
ID 1177
ThPP ID Th1022
Therapeutic Peptide/Protein Name Antihemophilic Factor
Sequence ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification Ia
Molecular Weight 264725.5
Chemical Formula C11794H18314N3220O3553S83
Isoelectric Point 6.97
Hydrophobicity -0.533
Melting Point (℃) N.A.
Half Life 8.4-19.3 hours
Description Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 4.1 mL/h/kg [Previously treated pediatric patients]
Categories Coagulants and Thrombotic agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name Xyntha
Company N.A.
Brand Discription Antihemophilic Factor (Recombinant), Plasma/Albumin-Free, the active ingredient in XYNTHA, is a recombinant coagulation factor VIII produced by recombinant DNA technology for use in therapy of factor VIII deficiency. The Antihemophilic Factor (Recombinant
Prescribed for Xyntha is used to treat or prevent bleeding episodes in adults and children with hemophilia A. It is also used to control bleeding related to surgery or dentistry in a person with hemophilia A.
Chemical Name N.A.
Formulation Each single-use vial contains nominally 250, 500, 1000 or 2000 IU of XYNTHA (antihemophilic factor) . Upon reconstitution, the product is a clear to slightly opalescent, colorless solution that contains sodium chloride, sucrose, L-histidine, calcium chlor
Physcial Appearance Sterile, nonpyrogenic, preservative-free, freeze-dried powder
Route of Administration Intravenous Injection
Recommended Dosage Required units = body weight (kg) x desired factor VIII rise (IU/dL or % of normal) x 0.5 (IU/kg per IU/dL)
Contraindication N.A.
Side Effects Chest pain; easy bruising, increased bleeding episodes; or bleeding from a wound or where the medicine was injected.
Useful Link http://www.xyntha.com/
PubMed ID 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure Th1022 (View) or (Download)

Entry 31
(31) Primary information
ID 1178
ThPP ID Th1022
Therapeutic Peptide/Protein Name Antihemophilic Factor
Sequence ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification Ia
Molecular Weight 264725.5
Chemical Formula C11794H18314N3220O3553S83
Isoelectric Point 6.97
Hydrophobicity -0.533
Melting Point (℃) N.A.
Half Life 8.4-19.3 hours
Description Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 4.1 mL/h/kg [Previously treated pediatric patients]
Categories Coagulants and Thrombotic agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Sore throat, cough, runny nose; fever or chills; mild nausea, vomiting; unusual or unpleasant taste in your mouth; skin itching or rash; warmth, redness, itching, or tingling under your skin; joint pain or swelling; dizziness; headache; or swelling, stinging, or irritation where the injection was given.
Useful Link http://www.drugs.com/xyntha.html
PubMed ID 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure Th1022 (View) or (Download)

Entry 32
(32) Primary information
ID 1179
ThPP ID Th1022
Therapeutic Peptide/Protein Name Antihemophilic Factor
Sequence ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification Ia
Molecular Weight 264725.5
Chemical Formula C11794H18314N3220O3553S83
Isoelectric Point 6.97
Hydrophobicity -0.533
Melting Point (℃) N.A.
Half Life 8.4-19.3 hours
Description Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 4.1 mL/h/kg [Previously treated pediatric patients]
Categories Coagulants and Thrombotic agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.rxlist.com/xyntha-drug.htm
PubMed ID 23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure Th1022 (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

(1) Primary information
Entry 1
ID	1148
ThPP ID	Th1022
Therapeutic Peptide/Protein Name	Antihemophilic Factor
Sequence	ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	264725.5
Chemical Formula	C11794H18314N3220O3553S83
Isoelectric Point	6.97
Hydrophobicity	-0.533
Melting Point (℃)	N.A.
Half Life	8.4-19.3 hours
Description	Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease	For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics	Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action	Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	4.1 mL/h/kg [Previously treated pediatric patients]
Categories	Coagulants and Thrombotic agents
Patents Number	CA2124690
Date of Issue	11/09/07
Date of Expiry	01/10/13
Drug Interaction	N.A.
Target	Coagulation factor X,Coagulation factor IX,von Willebrand factor,Phytanoyl-CoA dioxygenase, peroxisomal,Asialoglycoprotein receptor 2,78 kDa glucose-regulated protein,Calreticulin,Calnexin,Protein ERGIC-53,Prolow-density lipoprotein receptor-related protein 1,Multiple coagulation factor deficiency protein 2
Information of corresponding available drug in the market
Brand Name	Advate
Company	N.A.
Brand Discription	Advate contains antihemophilic factor, a naturally occurring protein in the blood that helps blood to clot. Advate works by temporarily raising levels of factor VIII in the blood to aid in clotting.
Prescribed for	ADVATE is a medicine used to replace clotting factor that is missing in people with hemophiliaÂ A. It is used to prevent and control bleeding in adults and children (0-16 years) with hemophiliaÂ A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	Powder form
Route of Administration	Intravenous Injection
Recommended Dosage	Dose (IU) = body weight (kg) _ Desired Factor VIII Rise (IU/dL or % of normal) _ 0.5 (IU/kg per IU/dL). So example, assuming assuming patient's baseline Factor VIII level is < 1% of normal = A dose of 1750 IU ADVATE administered to a 70 kg patient should be expected to result in a peak post-infusion Factor VIII increase of 1750 IU Ã— {[2 IU/dL]/[IU/kg]}/[70 kg] = 50 IU/dL (50% of normal).
Contraindication	Patients who have life-threatening hypersensitivity reactions, including anaphylaxis, to mouse or hamster protein or other constituents of the product.
Side Effects	Chest pain; easy bruising, increased bleeding episodes; or bleeding from a wound or where the medicine was injected.
Useful Link	http://www.advate.com/assets/pdf/advate_iri_pi.pdf
PubMed ID	23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure	Th1022 (View) or (Download)

(2) Primary information
Entry 2
ID	1149
ThPP ID	Th1022
Therapeutic Peptide/Protein Name	Antihemophilic Factor
Sequence	ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	264725.5
Chemical Formula	C11794H18314N3220O3553S83
Isoelectric Point	6.97
Hydrophobicity	-0.533
Melting Point (℃)	N.A.
Half Life	8.4-19.3 hours
Description	Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease	For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics	Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action	Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	4.1 mL/h/kg [Previously treated pediatric patients]
Categories	Coagulants and Thrombotic agents
Patents Number	CA1339477
Date of Issue	23/09/97
Date of Expiry	23/09/14
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Sore throat, cough, runny nose; fever or chills; mild nausea, vomiting; unusual or unpleasant taste in your mouth; skin itching or rash.
Useful Link	http://www.drugs.com/advate.html
PubMed ID	23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure	Th1022 (View) or (Download)

(3) Primary information
Entry 3
ID	1150
ThPP ID	Th1022
Therapeutic Peptide/Protein Name	Antihemophilic Factor
Sequence	ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	264725.5
Chemical Formula	C11794H18314N3220O3553S83
Isoelectric Point	6.97
Hydrophobicity	-0.533
Melting Point (℃)	N.A.
Half Life	8.4-19.3 hours
Description	Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease	For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics	Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action	Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	4.1 mL/h/kg [Previously treated pediatric patients]
Categories	Coagulants and Thrombotic agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Warmth, redness, itching, or tingling under your skin; joint pain or swelling; dizziness; headache; or swelling, stinging, or irritation where the injection was given.
Useful Link	http://www.baxter.com/healthcare_professionals/products/advate.html
PubMed ID	23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure	Th1022 (View) or (Download)

(4) Primary information
Entry 4
ID	1151
ThPP ID	Th1022
Therapeutic Peptide/Protein Name	Antihemophilic Factor
Sequence	ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	264725.5
Chemical Formula	C11794H18314N3220O3553S83
Isoelectric Point	6.97
Hydrophobicity	-0.533
Melting Point (℃)	N.A.
Half Life	8.4-19.3 hours
Description	Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease	For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics	Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action	Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	4.1 mL/h/kg [Previously treated pediatric patients]
Categories	Coagulants and Thrombotic agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Alphanate
Company	N.A.
Brand Discription	Alphanate(Solvent Detergent / Heat Treated) is a single dose, sterile, lyophilized concentrate of Factor VIII intended for intravenous administration in the treatment of hemophilia A, or acquired Factor VIII deficiency. Alphanate is prepared from pooled h
Prescribed for	It is used for preventing and controlling bleeding in adult patients with hemophilia A. It is also used to control certain types of bleeding episodes (eg, due to injury or surgery) in patients with von Willebrand disease.
Chemical Name	N.A.
Formulation	When reconstituted with the appropriate volume of Sterile Water for Injection, USP, Alphanate contains 0.3 - 0.9 g Albumin (Human)/100 mL; NMT 5 mmol calcium/L; NMT 750 Âµg glycine/IU FVIIIC; NMT 1.0 U heparin/mL; 10 - 40 mmol histidine/L; NMT 0.1 mg imida
Physcial Appearance	Lyophilized powder
Route of Administration	Intravenous Injection
Recommended Dosage	Bodyweight (in kg) X 0.50 lU/kg X Factor VIII Increase Desired (Percent) = Number of Factor VIII:C IU Required.
Contraindication	Contraindicated in patients who have manifested life-threatening immediate hypersensitivity reactions including anaphylaxis to any components of the product.
Side Effects	Rash; hives; itching; difficulty breathing; tightness in the chest; swelling of the mouth, face, lips, or tongue); back or stomach pain; calf pain, swelling, or tenderness; chest pain; coughing up blood; dark urine; fever or chills; new or worsening bruis
Useful Link	http://www.rxlist.com/alphanate-drug.htm
PubMed ID	23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure	Th1022 (View) or (Download)

(5) Primary information
Entry 5
ID	1152
ThPP ID	Th1022
Therapeutic Peptide/Protein Name	Antihemophilic Factor
Sequence	ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	264725.5
Chemical Formula	C11794H18314N3220O3553S83
Isoelectric Point	6.97
Hydrophobicity	-0.533
Melting Point (℃)	N.A.
Half Life	8.4-19.3 hours
Description	Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease	For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics	Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action	Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	4.1 mL/h/kg [Previously treated pediatric patients]
Categories	Coagulants and Thrombotic agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.drugs.com/cdi/alphanate.html
PubMed ID	23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure	Th1022 (View) or (Download)

(6) Primary information
Entry 6
ID	1153
ThPP ID	Th1022
Therapeutic Peptide/Protein Name	Antihemophilic Factor
Sequence	ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	264725.5
Chemical Formula	C11794H18314N3220O3553S83
Isoelectric Point	6.97
Hydrophobicity	-0.533
Melting Point (℃)	N.A.
Half Life	8.4-19.3 hours
Description	Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease	For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics	Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action	Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	4.1 mL/h/kg [Previously treated pediatric patients]
Categories	Coagulants and Thrombotic agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Bioclate
Company	Baxter Healthcare Corporation, Hyland Division and Genetics Institute, Inc.
Brand Discription	Bioclate is a glycoprotein synthesized by a genetically engineered Chinese Hamster Ovary cell line. In culture the CHO cell line secretes recombinant antihemophilic factor into the cell culture medium. The rAHF is purified from the culture medium utilizin
Prescribed for	To treat or prevent bleeding episodes in adults and children with hemophilia A. It is also used to control bleeding related to surgery or dentistry in a person with hemophilia.
Chemical Name	N.A.
Formulation	Biocolate is available in single-dose bottles which contain nominally 250, 500 and 1000 International Units per bottle.When reconstituted with the appropriate volume of diluent, it contains the following stabilizers in maximum amounts: 12.5 mg/mL Albumin
Physcial Appearance	Sterile, nonpyrogenic, off-white to faint yellow, lyophilized powder
Route of Administration	Intravenous infusion
Recommended Dosage	N.A.
Contraindication	Allergic
Side Effects	Chest pain; easy bruising, increased bleeding episodes; or bleeding from a wound or where the medicine was injected.
Useful Link	http://www.drugs.com/mtm/bioclate-recombinant.html
PubMed ID	23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure	Th1022 (View) or (Download)

(7) Primary information
Entry 7
ID	1154
ThPP ID	Th1022
Therapeutic Peptide/Protein Name	Antihemophilic Factor
Sequence	ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	264725.5
Chemical Formula	C11794H18314N3220O3553S83
Isoelectric Point	6.97
Hydrophobicity	-0.533
Melting Point (℃)	N.A.
Half Life	8.4-19.3 hours
Description	Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease	For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics	Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action	Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	4.1 mL/h/kg [Previously treated pediatric patients]
Categories	Coagulants and Thrombotic agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Sore throat, cough, runny nose; fever or chills; mild nausea, vomiting; unusual or unpleasant taste in your mouth; headache; dizziness; skin itching or rash.
Useful Link	http://www.rxlist.com/bioclate-drug.htm
PubMed ID	23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure	Th1022 (View) or (Download)

(8) Primary information
Entry 8
ID	1155
ThPP ID	Th1022
Therapeutic Peptide/Protein Name	Antihemophilic Factor
Sequence	ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	264725.5
Chemical Formula	C11794H18314N3220O3553S83
Isoelectric Point	6.97
Hydrophobicity	-0.533
Melting Point (℃)	N.A.
Half Life	8.4-19.3 hours
Description	Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease	For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics	Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action	Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	4.1 mL/h/kg [Previously treated pediatric patients]
Categories	Coagulants and Thrombotic agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Warmth, redness, itching, or tingling under your skin; joint pain or swelling; dizziness; headache; or swelling, stinging, or irritation where the injection was given.
Useful Link	http://www.webmd.com/drugs/2/drug-18250/bioclate-intravenous/details
PubMed ID	23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure	Th1022 (View) or (Download)

(9) Primary information
Entry 9
ID	1156
ThPP ID	Th1022
Therapeutic Peptide/Protein Name	Antihemophilic Factor
Sequence	ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	264725.5
Chemical Formula	C11794H18314N3220O3553S83
Isoelectric Point	6.97
Hydrophobicity	-0.533
Melting Point (℃)	N.A.
Half Life	8.4-19.3 hours
Description	Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease	For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics	Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action	Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	4.1 mL/h/kg [Previously treated pediatric patients]
Categories	Coagulants and Thrombotic agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Helixate FS
Company	N.A.
Brand Discription	Helixate FS has been manufactured using recombinant DNA technology and is produced by Baby Hamster Kidney cells into which the human factor VIII gene has been introduced. The cell culture medium contains Human Plasma Protein Solution and recombinant insul
Prescribed for	To control and prevent bleeding episodes in adults and children (0-16 years) with hemophilia A and also for surgical prophylaxis in adults and children with hemophilia A. It is also used for routine prophylactic treatment to reduce the frequency of bleedi
Chemical Name	N.A.
Formulation	Helixate is formulated with sucrose (0.9â€“1.3%), glycine (21â€“25 mg/mL), and histidine (18â€“23 mM) as stabilizers in the final container. The final product also contains calcium chloride (2â€“3 mM), sodium (27â€“36 mEq/L), chloride (32â€“40 mEq/L), polysorbate 80
Physcial Appearance	Sterile, stable, purified, nonpyrogenic, dried concentrate
Route of Administration	Intravenous Injection
Recommended Dosage	Dosage (units) = body weight (kg) _ desired factor VIII rise (IU/dL or % or normal) _ 0.5 (IU/kg per IU/dL)
Contraindication	Patients who have manifested life-threatening immediate hypersensitivity reactions, including anaphylaxis, to the product or its components, including mouse or hamster proteins.
Side Effects	Local injection site reactions
Useful Link	http://www.helixatefs.com/
PubMed ID	23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure	Th1022 (View) or (Download)

(10) Primary information
Entry 10
ID	1157
ThPP ID	Th1022
Therapeutic Peptide/Protein Name	Antihemophilic Factor
Sequence	ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	264725.5
Chemical Formula	C11794H18314N3220O3553S83
Isoelectric Point	6.97
Hydrophobicity	-0.533
Melting Point (℃)	N.A.
Half Life	8.4-19.3 hours
Description	Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease	For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics	Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action	Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	4.1 mL/h/kg [Previously treated pediatric patients]
Categories	Coagulants and Thrombotic agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Dizziness, rash , unusual taste in the mouth , mild increase in blood pressure
Useful Link	http://www.drugs.com/pro/helixate-fs.html
PubMed ID	23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure	Th1022 (View) or (Download)

(11) Primary information
Entry 11
ID	1158
ThPP ID	Th1022
Therapeutic Peptide/Protein Name	Antihemophilic Factor
Sequence	ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	264725.5
Chemical Formula	C11794H18314N3220O3553S83
Isoelectric Point	6.97
Hydrophobicity	-0.533
Melting Point (℃)	N.A.
Half Life	8.4-19.3 hours
Description	Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease	For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics	Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action	Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	4.1 mL/h/kg [Previously treated pediatric patients]
Categories	Coagulants and Thrombotic agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Pruritus , depersonalization , nausea , and rhinitis.
Useful Link	http://www.rxlist.com/helixate-fs-drug.htm
PubMed ID	23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure	Th1022 (View) or (Download)

(12) Primary information
Entry 12
ID	1159
ThPP ID	Th1022
Therapeutic Peptide/Protein Name	Antihemophilic Factor
Sequence	ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	264725.5
Chemical Formula	C11794H18314N3220O3553S83
Isoelectric Point	6.97
Hydrophobicity	-0.533
Melting Point (℃)	N.A.
Half Life	8.4-19.3 hours
Description	Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease	For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics	Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action	Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	4.1 mL/h/kg [Previously treated pediatric patients]
Categories	Coagulants and Thrombotic agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Hemofil M
Company	N.A.
Brand Discription	Hemofil M is a human clotting factor derived from pooled human plasma. It works by increasing the amount of clotting factor VII in the blood, helping the blood form clots and stop bleeding
Prescribed for	Preventing and controlling bleeding in patients with hemophilia A, including in surgical settings.
Chemical Name	N.A.
Formulation	HEMOFIL is available as single dose bottles that contain nominally 250 (NDC 0944-2930-01), 500 (NDC 0944-2931-01), 1000 (NDC 0944-2932-01), and 1700 (NDC 0944-2933-01) IU per bottle. Each bottle is labeled with the potency in International Units, and is p
Physcial Appearance	Dry concentrate
Route of Administration	Intravenous Injection
Recommended Dosage	The expected in vivo peak AHF level, expressed as IU/dL of plasma or percent of normal, can be calculated by multiplying the dose administered per kg body weight (IU/kg) by two.
Contraindication	Allergic
Side Effects	Rash; hives; itching; difficulty breathing; flushing; tightness in the chest; swelling of the mouth, face, lips, or tongue; wheezing; chest pain; fainting; nausea; severe or persistent dizziness or light-headedness; shortness of breath.
Useful Link	http://www.drugs.com/cdi/hemofil-m.html
PubMed ID	23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure	Th1022 (View) or (Download)

(13) Primary information
Entry 13
ID	1160
ThPP ID	Th1022
Therapeutic Peptide/Protein Name	Antihemophilic Factor
Sequence	ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	264725.5
Chemical Formula	C11794H18314N3220O3553S83
Isoelectric Point	6.97
Hydrophobicity	-0.533
Melting Point (℃)	N.A.
Half Life	8.4-19.3 hours
Description	Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease	For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics	Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action	Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	4.1 mL/h/kg [Previously treated pediatric patients]
Categories	Coagulants and Thrombotic agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.druglib.com/druginfo/hemofil-m/indications_dosage/
PubMed ID	23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure	Th1022 (View) or (Download)

(14) Primary information
Entry 14
ID	1161
ThPP ID	Th1022
Therapeutic Peptide/Protein Name	Antihemophilic Factor
Sequence	ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	264725.5
Chemical Formula	C11794H18314N3220O3553S83
Isoelectric Point	6.97
Hydrophobicity	-0.533
Melting Point (℃)	N.A.
Half Life	8.4-19.3 hours
Description	Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease	For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics	Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action	Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	4.1 mL/h/kg [Previously treated pediatric patients]
Categories	Coagulants and Thrombotic agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Hyate:C
Company	N.A.
Brand Discription	N.A.
Prescribed for	To treat and prevent serious bleeding episodes in patients with a bleeding problem called hemophilia A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	Powder
Route of Administration	Intravenous Injection
Recommended Dosage	N.A.
Contraindication	Allergic
Side Effects	Fever, changes in facial skin color, chills, fast or irregular breathing, nausea, puffiness or swelling of the eyelids or around the eyes, sensation of burning, warmth, heat, numbness, tightness, or tingling, skin rash, hives, or itching, tightness in the chest, troubled breathing, and unusual tiredness or weakness.
Useful Link	http://www.ncbi.nlm.nih.gov/pubmed/2499293
PubMed ID	23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure	Th1022 (View) or (Download)

(15) Primary information
Entry 15
ID	1162
ThPP ID	Th1022
Therapeutic Peptide/Protein Name	Antihemophilic Factor
Sequence	ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	264725.5
Chemical Formula	C11794H18314N3220O3553S83
Isoelectric Point	6.97
Hydrophobicity	-0.533
Melting Point (℃)	N.A.
Half Life	8.4-19.3 hours
Description	Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease	For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics	Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action	Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	4.1 mL/h/kg [Previously treated pediatric patients]
Categories	Coagulants and Thrombotic agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.drugs.com/cons/hyate-c.html
PubMed ID	23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure	Th1022 (View) or (Download)

(16) Primary information
Entry 16
ID	1163
ThPP ID	Th1022
Therapeutic Peptide/Protein Name	Antihemophilic Factor
Sequence	ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	264725.5
Chemical Formula	C11794H18314N3220O3553S83
Isoelectric Point	6.97
Hydrophobicity	-0.533
Melting Point (℃)	N.A.
Half Life	8.4-19.3 hours
Description	Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease	For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics	Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action	Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	4.1 mL/h/kg [Previously treated pediatric patients]
Categories	Coagulants and Thrombotic agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.webmd.com/drugs/2/drug-75943/hyatec-intravenous/details#interactions
PubMed ID	23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure	Th1022 (View) or (Download)

(17) Primary information
Entry 17
ID	1164
ThPP ID	Th1022
Therapeutic Peptide/Protein Name	Antihemophilic Factor
Sequence	ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	264725.5
Chemical Formula	C11794H18314N3220O3553S83
Isoelectric Point	6.97
Hydrophobicity	-0.533
Melting Point (℃)	N.A.
Half Life	8.4-19.3 hours
Description	Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease	For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics	Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action	Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	4.1 mL/h/kg [Previously treated pediatric patients]
Categories	Coagulants and Thrombotic agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Koate-HP
Company	N.A.
Brand Discription	Koate-HP is a naturally occurring protein in the blood that helps to clot. A lack of antihemophilic factor VIII is the cause of hemophilia A.
Prescribed for	To control and prevent bleeding episodes in people with low levels of factor VIII. It is also used in these patients before surgery to prevent bleeding. People with low factor VIII levels are at risk for bleeding longer after an injury/surgery and for ble
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	Powder
Route of Administration	Intravenous Injection
Recommended Dosage	N.A.
Contraindication	Allergic
Side Effects	Nausea, stomach pain, low fever, loss of appetite, dark urine, clay-colored stools, jaundice (yellowing of the skin or eyes); fever, chills, runny nose, and drowsiness followed about 2 weeks later by a rash and joint pain; fast heart rate, chest pain, troubled breathing and unusual tiredness.
Useful Link	http://www.prescriptiondrugs.com/drugs/koate-hp
PubMed ID	23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure	Th1022 (View) or (Download)

(18) Primary information
Entry 18
ID	1165
ThPP ID	Th1022
Therapeutic Peptide/Protein Name	Antihemophilic Factor
Sequence	ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	264725.5
Chemical Formula	C11794H18314N3220O3553S83
Isoelectric Point	6.97
Hydrophobicity	-0.533
Melting Point (℃)	N.A.
Half Life	8.4-19.3 hours
Description	Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease	For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics	Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action	Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	4.1 mL/h/kg [Previously treated pediatric patients]
Categories	Coagulants and Thrombotic agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Unusual taste in your mouth; cough, runny or stuffy nose; mild itching; swelling in your hands, ankles, or feet; headache or dizziness; mild nausea, diarrhea, stomach pain; sweating; joint pain; or chills or flushing (warmth or tingly feeling).
Useful Link	http://www.drugs.com/mtm/koate-hp-injection.html
PubMed ID	23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure	Th1022 (View) or (Download)

(19) Primary information
Entry 19
ID	1166
ThPP ID	Th1022
Therapeutic Peptide/Protein Name	Antihemophilic Factor
Sequence	ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	264725.5
Chemical Formula	C11794H18314N3220O3553S83
Isoelectric Point	6.97
Hydrophobicity	-0.533
Melting Point (℃)	N.A.
Half Life	8.4-19.3 hours
Description	Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease	For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics	Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action	Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	4.1 mL/h/kg [Previously treated pediatric patients]
Categories	Coagulants and Thrombotic agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Kogenate FS
Company	N.A.
Brand Discription	Kogenate FS is a coagulation factor VIII produced by recombinant DNA technology. It is produced by Baby Hamster Kidney cells into which the human factor VIII gene has been introduced. The cell culture medium contains Human Plasma Protein Solution and reco
Prescribed for	Kogenate FS is used to treat or prevent bleeding episodes in adults and children with hemophilia A. It is also used to control bleeding related to surgery or dentistry in a person with hemophilia, and to prevent joint damage in people age 16 or older with
Chemical Name	N.A.
Formulation	Kogenate FS is formulated with Sucrose ( 0.9- 1.3%), glycine (210-25mg/ml), histidine (18-23 mmol/L) as stablizers and 27-36mEq/L sodium, 2.0-3.0 mmol/L calcium, 32-40 mEq/L chloride, 64-96 _g/mL polysorbate 80, 28 mg/vial sucrose and trace amounts of Imi
Physcial Appearance	Powder
Route of Administration	Intravenous Injection
Recommended Dosage	N.A.
Contraindication	Allergic
Side Effects	Chest pain; easy bruising, increased bleeding episodes; or bleeding from a wound or where the medicine was injected.
Useful Link	http://www.drugs.com/kogenate.html
PubMed ID	23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure	Th1022 (View) or (Download)

(20) Primary information
Entry 20
ID	1167
ThPP ID	Th1022
Therapeutic Peptide/Protein Name	Antihemophilic Factor
Sequence	ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	264725.5
Chemical Formula	C11794H18314N3220O3553S83
Isoelectric Point	6.97
Hydrophobicity	-0.533
Melting Point (℃)	N.A.
Half Life	8.4-19.3 hours
Description	Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease	For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics	Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action	Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	4.1 mL/h/kg [Previously treated pediatric patients]
Categories	Coagulants and Thrombotic agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Sore throat, cough, runny nose; fever or chills; mild nausea, vomiting; unusual or unpleasant taste in your mouth; skin itching or rash; warmth, redness, itching, or tingling under your skin; joint pain or swelling; dizziness; headache; or swelling, stinging, or irritation where the injection was given.
Useful Link	http://www.rxlist.com/kogenate-fs-drug.htm
PubMed ID	23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure	Th1022 (View) or (Download)

(21) Primary information
Entry 21
ID	1168
ThPP ID	Th1022
Therapeutic Peptide/Protein Name	Antihemophilic Factor
Sequence	ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	264725.5
Chemical Formula	C11794H18314N3220O3553S83
Isoelectric Point	6.97
Hydrophobicity	-0.533
Melting Point (℃)	N.A.
Half Life	8.4-19.3 hours
Description	Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease	For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics	Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action	Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	4.1 mL/h/kg [Previously treated pediatric patients]
Categories	Coagulants and Thrombotic agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.kogenatefs.com/index.php/about-kogenate
PubMed ID	23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure	Th1022 (View) or (Download)

(22) Primary information
Entry 22
ID	1169
ThPP ID	Th1022
Therapeutic Peptide/Protein Name	Antihemophilic Factor
Sequence	ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	264725.5
Chemical Formula	C11794H18314N3220O3553S83
Isoelectric Point	6.97
Hydrophobicity	-0.533
Melting Point (℃)	N.A.
Half Life	8.4-19.3 hours
Description	Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease	For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics	Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action	Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	4.1 mL/h/kg [Previously treated pediatric patients]
Categories	Coagulants and Thrombotic agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Monarc-M
Company	N.A.
Brand Discription	It is antihyemophilic factor.
Prescribed for	To treat and prevent serious bleeding episodes in patients with hemophilia A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	Powder
Route of Administration	Intravenous Injection
Recommended Dosage	N.A.
Contraindication	Allergic
Side Effects	Blurred vision, flushing, headache, nausea, vomiting
Useful Link	http://www.drugs.com/cons/monarc-m.html
PubMed ID	23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure	Th1022 (View) or (Download)

(23) Primary information
Entry 23
ID	1170
ThPP ID	Th1022
Therapeutic Peptide/Protein Name	Antihemophilic Factor
Sequence	ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	264725.5
Chemical Formula	C11794H18314N3220O3553S83
Isoelectric Point	6.97
Hydrophobicity	-0.533
Melting Point (℃)	N.A.
Half Life	8.4-19.3 hours
Description	Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease	For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics	Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action	Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	4.1 mL/h/kg [Previously treated pediatric patients]
Categories	Coagulants and Thrombotic agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Allergic reactions like skin rash, itching or hives, swelling of the face, lips, or tongue, chest pain, fast, irregular heartbeat, feeling faint or lightheaded, falls, fever or chills, flu-like symptoms, numbness or tingling in hands or feet, pain, redness or swelling at the injection site, stomach pain, unusually weak or tired and yellowing of the eyes or skin.
Useful Link	http://www.cvs.com/drug/monarc-m
PubMed ID	23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure	Th1022 (View) or (Download)

(24) Primary information
Entry 24
ID	1171
ThPP ID	Th1022
Therapeutic Peptide/Protein Name	Antihemophilic Factor
Sequence	ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	264725.5
Chemical Formula	C11794H18314N3220O3553S83
Isoelectric Point	6.97
Hydrophobicity	-0.533
Melting Point (℃)	N.A.
Half Life	8.4-19.3 hours
Description	Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease	For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics	Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action	Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	4.1 mL/h/kg [Previously treated pediatric patients]
Categories	Coagulants and Thrombotic agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Monoclate-P
Company	N.A.
Brand Discription	Monoclate-P, Factor VIII:C Pasteurized, Monoclonal Antibody Purified, is a sterile, stable, lyophilized concentrate of Factor VIII:C with reduced amounts of VWF:Ag and purified of extraneous plasma-derived protein by use of affinity chromatography. A muri
Prescribed for	To control and prevent bleeding episodes in people with hemophilia A. It is also used in these patients before surgery to prevent bleeding.
Chemical Name	N.A.
Formulation	Each vial contains the labeled amount of antihemophilic factor (AHF) activity as expressed in terms of International Units (I.U.) of antihemophilic activity. One unit of antihemophilic activity is equivalent to that quantity of AHF present in one mL of no
Physcial Appearance	Lyophilized powder for solution
Route of Administration	Intravenous Injection
Recommended Dosage	The following formula provides a guide of dosage calculations for both adult and pediatric patients:Number of AHF I.U. Required = Body weight(in kg) x desired Factor VIII increase(% normal) x 0.5
Contraindication	Hypersensitivity to mouse protein
Side Effects	Products of this type are known to cause allergic reactions, mild chills, nausea or stinging at the infusion site. In some cases, inhibitors of FVIII may occur.
Useful Link	http://www.abopharmaceuticals.com/ProductSheets/MonoclateP.pdf
PubMed ID	23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure	Th1022 (View) or (Download)

(25) Primary information
Entry 25
ID	1172
ThPP ID	Th1022
Therapeutic Peptide/Protein Name	Antihemophilic Factor
Sequence	ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	264725.5
Chemical Formula	C11794H18314N3220O3553S83
Isoelectric Point	6.97
Hydrophobicity	-0.533
Melting Point (℃)	N.A.
Half Life	8.4-19.3 hours
Description	Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease	For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics	Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action	Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	4.1 mL/h/kg [Previously treated pediatric patients]
Categories	Coagulants and Thrombotic agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.drugs.com/pro/monoclate-p.html
PubMed ID	23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure	Th1022 (View) or (Download)

(26) Primary information
Entry 26
ID	1173
ThPP ID	Th1022
Therapeutic Peptide/Protein Name	Antihemophilic Factor
Sequence	ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	264725.5
Chemical Formula	C11794H18314N3220O3553S83
Isoelectric Point	6.97
Hydrophobicity	-0.533
Melting Point (℃)	N.A.
Half Life	8.4-19.3 hours
Description	Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease	For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics	Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action	Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	4.1 mL/h/kg [Previously treated pediatric patients]
Categories	Coagulants and Thrombotic agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.rxlist.com/monoclate-p-drug.htm
PubMed ID	23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure	Th1022 (View) or (Download)

(27) Primary information
Entry 27
ID	1174
ThPP ID	Th1022
Therapeutic Peptide/Protein Name	Antihemophilic Factor
Sequence	ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	264725.5
Chemical Formula	C11794H18314N3220O3553S83
Isoelectric Point	6.97
Hydrophobicity	-0.533
Melting Point (℃)	N.A.
Half Life	8.4-19.3 hours
Description	Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease	For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics	Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action	Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	4.1 mL/h/kg [Previously treated pediatric patients]
Categories	Coagulants and Thrombotic agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	ReFacto
Company	N.A.
Brand Discription	ReFacto Antihemophilic Factor (Recombinant) is a purified protein produced by recombinant DNA technology for use in therapy of factor VIII deficiency. ReFacto (antihemophilic factor) is a glycoprotein with an approximate molecular mass of 170 kDa consisti
Prescribed for	To control and prevent hemorrhagic episodes and for surgical prophylaxis in patients with hemophilia A. ReFacto is indicated for short-term routine prophylaxis to reduce the frequency of spontaneous bleeding episodes
Chemical Name	N.A.
Formulation	It is available in single-use vials containing the labeled amount of factor VIII activity. Each vial contains nominally 250, 500, 1000 or 2000 IU of ReFacto (antihemophilic factor) per vial. The formulated product is a clear colorless solution upon recons
Physcial Appearance	Lyophilized powder
Route of Administration	Intravenous Injection
Recommended Dosage	Required units = body weight (kg)x desired factor VIII rise (IU/dL or % of normal)x 0.5 (IU/kg per IU/dL)
Contraindication	Known hypersensitivity to mouse or hamster proteins
Side Effects	Chest pain; easy bruising, increased bleeding episodes; or bleeding from a wound or where the medicine was injected.
Useful Link	http://www.drugs.com/mtm/refacto-recombinant.html
PubMed ID	23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure	Th1022 (View) or (Download)

(28) Primary information
Entry 28
ID	1175
ThPP ID	Th1022
Therapeutic Peptide/Protein Name	Antihemophilic Factor
Sequence	ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	264725.5
Chemical Formula	C11794H18314N3220O3553S83
Isoelectric Point	6.97
Hydrophobicity	-0.533
Melting Point (℃)	N.A.
Half Life	8.4-19.3 hours
Description	Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease	For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics	Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action	Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	4.1 mL/h/kg [Previously treated pediatric patients]
Categories	Coagulants and Thrombotic agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Sore throat, cough, runny nose; fever or chills; mild nausea, vomiting; unusual or unpleasant taste in your mouth; skin itching or rash; warmth, redness, itching, or tingling under your skin; joint pain or swelling; dizziness; headache; or swelling, stinging, or irritation where the injection was given.
Useful Link	http://www.medicines.org.uk/emc/medicine/21767/SPC
PubMed ID	23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure	Th1022 (View) or (Download)

(29) Primary information
Entry 29
ID	1176
ThPP ID	Th1022
Therapeutic Peptide/Protein Name	Antihemophilic Factor
Sequence	ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	264725.5
Chemical Formula	C11794H18314N3220O3553S83
Isoelectric Point	6.97
Hydrophobicity	-0.533
Melting Point (℃)	N.A.
Half Life	8.4-19.3 hours
Description	Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease	For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics	Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action	Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	4.1 mL/h/kg [Previously treated pediatric patients]
Categories	Coagulants and Thrombotic agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.rxlist.com/refacto-drug.htm
PubMed ID	23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure	Th1022 (View) or (Download)

(30) Primary information
Entry 30
ID	1177
ThPP ID	Th1022
Therapeutic Peptide/Protein Name	Antihemophilic Factor
Sequence	ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTL view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	264725.5
Chemical Formula	C11794H18314N3220O3553S83
Isoelectric Point	6.97
Hydrophobicity	-0.533
Melting Point (℃)	N.A.
Half Life	8.4-19.3 hours
Description	Human recombinant antihemophilic factor or Factor VIII of 2332 residues(glycosylated) is produced by CHO cells.
Indication/Disease	For the treatment of hemophilia A, von Willebrand disease and Factor XIII deficiency.
Pharmacodynamics	Antihemophilic Factor binds factor IXa along with calcium and phospholipid, this complex converts factor X to factor Xa to facilitate clotting cascade.
Mechanism of Action	Antihemophilic factor is a protein found in normal plasma which is necessary for clot formation. The administration of AHF provides an increase in plasma levels of AHF and can temporarily correct the coagulation defect of patients with hemophilia A.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	4.1 mL/h/kg [Previously treated pediatric patients]
Categories	Coagulants and Thrombotic agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Xyntha
Company	N.A.
Brand Discription	Antihemophilic Factor (Recombinant), Plasma/Albumin-Free, the active ingredient in XYNTHA, is a recombinant coagulation factor VIII produced by recombinant DNA technology for use in therapy of factor VIII deficiency. The Antihemophilic Factor (Recombinant
Prescribed for	Xyntha is used to treat or prevent bleeding episodes in adults and children with hemophilia A. It is also used to control bleeding related to surgery or dentistry in a person with hemophilia A.
Chemical Name	N.A.
Formulation	Each single-use vial contains nominally 250, 500, 1000 or 2000 IU of XYNTHA (antihemophilic factor) . Upon reconstitution, the product is a clear to slightly opalescent, colorless solution that contains sodium chloride, sucrose, L-histidine, calcium chlor
Physcial Appearance	Sterile, nonpyrogenic, preservative-free, freeze-dried powder
Route of Administration	Intravenous Injection
Recommended Dosage	Required units = body weight (kg) x desired factor VIII rise (IU/dL or % of normal) x 0.5 (IU/kg per IU/dL)
Contraindication	N.A.
Side Effects	Chest pain; easy bruising, increased bleeding episodes; or bleeding from a wound or where the medicine was injected.
Useful Link	http://www.xyntha.com/
PubMed ID	23803235, 23105376, 8328652, 2341766, 4708094, 2831669, 27445511, 25136251, 6197726
3-D Structure	Th1022 (View) or (Download)