| Entry 1 |
| (1) Primary information |
|---|
| ID | 1210 |
| ThPP ID | Th1028 |
| Therapeutic Peptide/Protein Name | Tenecteplase |
| Sequence | SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS view full sequnce in fasta |
| Functional Classification | Ib |
| Molecular Weight | 58951.2 |
| Chemical Formula | C2561H3919N747O781S40 |
| Isoelectric Point | 7.61 |
| Hydrophobicity | -0.528 |
| Melting Point (℃) | 60 |
| Half Life | 1.9 hours (mammalian reticulocytes, in vitro) |
| Description | Tenecteplase(527 amino acid) is a glycoprotein developed by introducing the following modifications to the complementary DNA for natural human tPA: a substitution of threonine 103 with asparagine, and a substitution of asparagine 117 with glutamine, both within the kringle 1 domain, and a tetra-alanine substitution at amino acids 296-299 in the protease domain. |
| Indication/Disease | To treat myocardial infarction and lysis of intracoronary emboli. |
| Pharmacodynamics | Tenecteplase is a fibrin-specific tissue-plasminogen activator. It binds to fibrin rich clots and cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. This helps eliminate blood clots or arterial blockages that cause myocardial infarction. |
| Mechanism of Action | Tenecteplase binds to fibrin rich clots via the fibronectin finger-like domain and the Kringle 2 domain. The protease domain then cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 99 - 119 mL/min [acute myocardial infarction patients] |
| Categories | Fibrinolytic Agents |
| Patents Number | CA2129660 |
| Date of Issue | 28/06/05 |
| Date of Expiry | 28/05/13 |
| Drug Interaction | Aprotonin may antagonize the effect of Tenecteplase. Monitor for decreased effects of Tenecteplase. |
| Target | Plasminogen,Fibrinogen alpha chain,Urokinase plasminogen activator surface receptor,Plasminogen activator inhibitor 1,Plasminogen activator inhibitor 2,Tetranectin,Keratin, type II cytoskeletal 8,Annexin A2,Calreticulin,Calnexin,Prolow-density lipoprotein |
| Information of corresponding available drug in the market |
|---|
| Brand Name | TNKase |
| Company | Genentech Inc |
| Brand Discription | TNKase is a tissue plasminogen activator produced by recombinant DNA technology using an established mammalian cell line of Chinese Hamster Ovary cells. Tenecteplase(527 amino acid) is a glycoprotein developed by introducing the following modifications to |
| Prescribed for | To prevent death from a heart attack (acute myocardial infarction). |
| Chemical Name | N.A. |
| Formulation | Each vial of TNKase nominally contains 52.5 mg Tenecteplase, 0.55 g L-arginine, 0.17 g phosphoric acid, and 4.3 mg polysorbate 20, which includes a 5% overfill. Each vial will deliver 50 mg of Tenecteplase. |
| Physcial Appearance | Sterile, white to off-white, lyophilized powder |
| Route of Administration | Intravenous Injection |
| Recommended Dosage | The recommended total dose should not exceed 50 mg and is based upon patient weight. For less than 60 kg of body weight recommended dose is 30 mg of TNKase. Similarly 35 mg for 60-70 kg, 40 mg for 70-80 kg, 45 mg for 80-90 kg and 50 mg for more than 90 kg. |
| Contraindication | Active internal bleeding, History of cerebrovascular accident |
| Side Effects | Nausea, vomiting; or fever. |
| Useful Link | http://www.drugs.com/mtm/tnkase.html |
| PubMed ID | 16488800, 16380055, 16084152, 15744554, 15650539 |
| 3-D Structure | Th1028 (View) or (Download) |
| Entry 2 |
| (2) Primary information |
|---|
| ID | 1211 |
| ThPP ID | Th1028 |
| Therapeutic Peptide/Protein Name | Tenecteplase |
| Sequence | SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS view full sequnce in fasta |
| Functional Classification | Ib |
| Molecular Weight | 58951.2 |
| Chemical Formula | C2561H3919N747O781S40 |
| Isoelectric Point | 7.61 |
| Hydrophobicity | -0.528 |
| Melting Point (℃) | 60 |
| Half Life | 1.9 hours (mammalian reticulocytes, in vitro) |
| Description | Tenecteplase(527 amino acid) is a glycoprotein developed by introducing the following modifications to the complementary DNA for natural human tPA: a substitution of threonine 103 with asparagine, and a substitution of asparagine 117 with glutamine, both within the kringle 1 domain, and a tetra-alanine substitution at amino acids 296-299 in the protease domain. |
| Indication/Disease | To treat myocardial infarction and lysis of intracoronary emboli. |
| Pharmacodynamics | Tenecteplase is a fibrin-specific tissue-plasminogen activator. It binds to fibrin rich clots and cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. This helps eliminate blood clots or arterial blockages that cause myocardial infarction. |
| Mechanism of Action | Tenecteplase binds to fibrin rich clots via the fibronectin finger-like domain and the Kringle 2 domain. The protease domain then cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 99 - 119 mL/min [acute myocardial infarction patients] |
| Categories | Thrombolytic Agents |
| Patents Number | CA1341432 |
| Date of Issue | 17/06/03 |
| Date of Expiry | 17/06/20 |
| Drug Interaction | Drotrecogin alfa increases risk of bleeding. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | Intracranial neoplasm, Known bleeding diathesis |
| Side Effects | Chest pain, slow or uneven heartbeats; pain, swelling, hot or cold feeling, skin changes, or discoloration anywhere on your body; sudden leg or foot pain, foot ulcer, purple toes or fingers; swelling or severe pain or signs of infection in your fingers. |
| Useful Link | http://www.rxlist.com/tnkase-drug.htm |
| PubMed ID | 16488800, 16380055, 16084152, 15744554, 15650539 |
| 3-D Structure | Th1028 (View) or (Download) |
| Entry 3 |
| (3) Primary information |
|---|
| ID | 1212 |
| ThPP ID | Th1028 |
| Therapeutic Peptide/Protein Name | Tenecteplase |
| Sequence | SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS view full sequnce in fasta |
| Functional Classification | Ib |
| Molecular Weight | 58951.2 |
| Chemical Formula | C2561H3919N747O781S40 |
| Isoelectric Point | 7.61 |
| Hydrophobicity | -0.528 |
| Melting Point (℃) | 60 |
| Half Life | 1.9 hours (mammalian reticulocytes, in vitro) |
| Description | Tenecteplase(527 amino acid) is a glycoprotein developed by introducing the following modifications to the complementary DNA for natural human tPA: a substitution of threonine 103 with asparagine, and a substitution of asparagine 117 with glutamine, both within the kringle 1 domain, and a tetra-alanine substitution at amino acids 296-299 in the protease domain. |
| Indication/Disease | To treat myocardial infarction and lysis of intracoronary emboli. |
| Pharmacodynamics | Tenecteplase is a fibrin-specific tissue-plasminogen activator. It binds to fibrin rich clots and cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. This helps eliminate blood clots or arterial blockages that cause myocardial infarction. |
| Mechanism of Action | Tenecteplase binds to fibrin rich clots via the fibronectin finger-like domain and the Kringle 2 domain. The protease domain then cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 99 - 119 mL/min [acute myocardial infarction patients] |
| Categories | N.A. |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | Additive anticoagulant/antiplatelet effects may increase bleed risk, so Ginkgo biloba's (DB01381) concomitant therapy should be avoided. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | Intracranial or intraspinal surgery or trauma within 2 months |
| Side Effects | Sudden numbness or weakness, problems with speech or balance, vision problems; little or no urinating; unexplained muscle pain. |
| Useful Link | N.A. |
| PubMed ID | 16488800, 16380055, 16084152, 15744554, 15650539 |
| 3-D Structure | Th1028 (View) or (Download) |
| Entry 4 |
| (4) Primary information |
|---|
| ID | 1213 |
| ThPP ID | Th1028 |
| Therapeutic Peptide/Protein Name | Tenecteplase |
| Sequence | SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS view full sequnce in fasta |
| Functional Classification | Ib |
| Molecular Weight | 58951.2 |
| Chemical Formula | C2561H3919N747O781S40 |
| Isoelectric Point | 7.61 |
| Hydrophobicity | -0.528 |
| Melting Point (℃) | 60 |
| Half Life | 1.9 hours (mammalian reticulocytes, in vitro) |
| Description | Tenecteplase(527 amino acid) is a glycoprotein developed by introducing the following modifications to the complementary DNA for natural human tPA: a substitution of threonine 103 with asparagine, and a substitution of asparagine 117 with glutamine, both within the kringle 1 domain, and a tetra-alanine substitution at amino acids 296-299 in the protease domain. |
| Indication/Disease | To treat myocardial infarction and lysis of intracoronary emboli. |
| Pharmacodynamics | Tenecteplase is a fibrin-specific tissue-plasminogen activator. It binds to fibrin rich clots and cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. This helps eliminate blood clots or arterial blockages that cause myocardial infarction. |
| Mechanism of Action | Tenecteplase binds to fibrin rich clots via the fibronectin finger-like domain and the Kringle 2 domain. The protease domain then cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 99 - 119 mL/min [acute myocardial infarction patients] |
| Categories | N.A. |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | Ginseng increases risk of bleeding. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | Arteriovenous malformation or aneurysm |
| Side Effects | Muscle weakness or loss of function, loss of bowel or bladder control; or severe pain in your upper stomach spreading to your back. |
| Useful Link | N.A. |
| PubMed ID | 16488800, 16380055, 16084152, 15744554, 15650539 |
| 3-D Structure | Th1028 (View) or (Download) |
| Entry 5 |
| (5) Primary information |
|---|
| ID | 1214 |
| ThPP ID | Th1028 |
| Therapeutic Peptide/Protein Name | Tenecteplase |
| Sequence | SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS view full sequnce in fasta |
| Functional Classification | Ib |
| Molecular Weight | 58951.2 |
| Chemical Formula | C2561H3919N747O781S40 |
| Isoelectric Point | 7.61 |
| Hydrophobicity | -0.528 |
| Melting Point (℃) | 60 |
| Half Life | 1.9 hours (mammalian reticulocytes, in vitro) |
| Description | Tenecteplase(527 amino acid) is a glycoprotein developed by introducing the following modifications to the complementary DNA for natural human tPA: a substitution of threonine 103 with asparagine, and a substitution of asparagine 117 with glutamine, both within the kringle 1 domain, and a tetra-alanine substitution at amino acids 296-299 in the protease domain. |
| Indication/Disease | To treat myocardial infarction and lysis of intracoronary emboli. |
| Pharmacodynamics | Tenecteplase is a fibrin-specific tissue-plasminogen activator. It binds to fibrin rich clots and cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. This helps eliminate blood clots or arterial blockages that cause myocardial infarction. |
| Mechanism of Action | Tenecteplase binds to fibrin rich clots via the fibronectin finger-like domain and the Kringle 2 domain. The protease domain then cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | 99 - 119 mL/min [acute myocardial infarction patients] |
| Categories | N.A. |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | Ticlopidine increases bleeding risk. Monitor for signs of bleeding. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | Severe uncontrolled hypertension |
| Side Effects | Tenderness, or weakness especially if you also have fever, unusual tiredness, and dark colored urine. |
| Useful Link | N.A. |
| PubMed ID | 16488800, 16380055, 16084152, 15744554, 15650539 |
| 3-D Structure | Th1028 (View) or (Download) |