Detailed description page of THPdb

Details of Th1028 which contains 5 entries.

Entry 1
(1) Primary information
ID 1210
ThPP ID Th1028
Therapeutic Peptide/Protein Name Tenecteplase
Sequence SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS view full sequnce in fasta
Functional Classification Ib
Molecular Weight 58951.2
Chemical Formula C2561H3919N747O781S40
Isoelectric Point 7.61
Hydrophobicity -0.528
Melting Point (℃) 60
Half Life 1.9 hours (mammalian reticulocytes, in vitro)
Description Tenecteplase(527 amino acid) is a glycoprotein developed by introducing the following modifications to the complementary DNA for natural human tPA: a substitution of threonine 103 with asparagine, and a substitution of asparagine 117 with glutamine, both within the kringle 1 domain, and a tetra-alanine substitution at amino acids 296-299 in the protease domain.
Indication/Disease To treat myocardial infarction and lysis of intracoronary emboli.
Pharmacodynamics Tenecteplase is a fibrin-specific tissue-plasminogen activator. It binds to fibrin rich clots and cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. This helps eliminate blood clots or arterial blockages that cause myocardial infarction.
Mechanism of Action Tenecteplase binds to fibrin rich clots via the fibronectin finger-like domain and the Kringle 2 domain. The protease domain then cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 99 - 119 mL/min [acute myocardial infarction patients]
Categories Fibrinolytic Agents
Patents Number CA2129660
Date of Issue 28/06/05
Date of Expiry 28/05/13
Drug Interaction Aprotonin may antagonize the effect of Tenecteplase. Monitor for decreased effects of Tenecteplase.
Target Plasminogen,Fibrinogen alpha chain,Urokinase plasminogen activator surface receptor,Plasminogen activator inhibitor 1,Plasminogen activator inhibitor 2,Tetranectin,Keratin, type II cytoskeletal 8,Annexin A2,Calreticulin,Calnexin,Prolow-density lipoprotein
Information of corresponding available drug in the market
Brand Name TNKase
Company Genentech Inc
Brand Discription TNKase is a tissue plasminogen activator produced by recombinant DNA technology using an established mammalian cell line of Chinese Hamster Ovary cells. Tenecteplase(527 amino acid) is a glycoprotein developed by introducing the following modifications to
Prescribed for To prevent death from a heart attack (acute myocardial infarction).
Chemical Name N.A.
Formulation Each vial of TNKase nominally contains 52.5 mg Tenecteplase, 0.55 g L-arginine, 0.17 g phosphoric acid, and 4.3 mg polysorbate 20, which includes a 5% overfill. Each vial will deliver 50 mg of Tenecteplase.
Physcial Appearance Sterile, white to off-white, lyophilized powder
Route of Administration Intravenous Injection
Recommended Dosage The recommended total dose should not exceed 50 mg and is based upon patient weight. For less than 60 kg of body weight recommended dose is 30 mg of TNKase. Similarly 35 mg for 60-70 kg, 40 mg for 70-80 kg, 45 mg for 80-90 kg and 50 mg for more than 90 kg.
Contraindication Active internal bleeding, History of cerebrovascular accident
Side Effects Nausea, vomiting; or fever.
Useful Link http://www.drugs.com/mtm/tnkase.html
PubMed ID 16488800, 16380055, 16084152, 15744554, 15650539
3-D Structure Th1028 (View) or (Download)

Entry 2
(2) Primary information
ID 1211
ThPP ID Th1028
Therapeutic Peptide/Protein Name Tenecteplase
Sequence SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS view full sequnce in fasta
Functional Classification Ib
Molecular Weight 58951.2
Chemical Formula C2561H3919N747O781S40
Isoelectric Point 7.61
Hydrophobicity -0.528
Melting Point (℃) 60
Half Life 1.9 hours (mammalian reticulocytes, in vitro)
Description Tenecteplase(527 amino acid) is a glycoprotein developed by introducing the following modifications to the complementary DNA for natural human tPA: a substitution of threonine 103 with asparagine, and a substitution of asparagine 117 with glutamine, both within the kringle 1 domain, and a tetra-alanine substitution at amino acids 296-299 in the protease domain.
Indication/Disease To treat myocardial infarction and lysis of intracoronary emboli.
Pharmacodynamics Tenecteplase is a fibrin-specific tissue-plasminogen activator. It binds to fibrin rich clots and cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. This helps eliminate blood clots or arterial blockages that cause myocardial infarction.
Mechanism of Action Tenecteplase binds to fibrin rich clots via the fibronectin finger-like domain and the Kringle 2 domain. The protease domain then cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 99 - 119 mL/min [acute myocardial infarction patients]
Categories Thrombolytic Agents
Patents Number CA1341432
Date of Issue 17/06/03
Date of Expiry 17/06/20
Drug Interaction Drotrecogin alfa increases risk of bleeding.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Intracranial neoplasm, Known bleeding diathesis
Side Effects Chest pain, slow or uneven heartbeats; pain, swelling, hot or cold feeling, skin changes, or discoloration anywhere on your body; sudden leg or foot pain, foot ulcer, purple toes or fingers; swelling or severe pain or signs of infection in your fingers.
Useful Link http://www.rxlist.com/tnkase-drug.htm
PubMed ID 16488800, 16380055, 16084152, 15744554, 15650539
3-D Structure Th1028 (View) or (Download)

Entry 3
(3) Primary information
ID 1212
ThPP ID Th1028
Therapeutic Peptide/Protein Name Tenecteplase
Sequence SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS view full sequnce in fasta
Functional Classification Ib
Molecular Weight 58951.2
Chemical Formula C2561H3919N747O781S40
Isoelectric Point 7.61
Hydrophobicity -0.528
Melting Point (℃) 60
Half Life 1.9 hours (mammalian reticulocytes, in vitro)
Description Tenecteplase(527 amino acid) is a glycoprotein developed by introducing the following modifications to the complementary DNA for natural human tPA: a substitution of threonine 103 with asparagine, and a substitution of asparagine 117 with glutamine, both within the kringle 1 domain, and a tetra-alanine substitution at amino acids 296-299 in the protease domain.
Indication/Disease To treat myocardial infarction and lysis of intracoronary emboli.
Pharmacodynamics Tenecteplase is a fibrin-specific tissue-plasminogen activator. It binds to fibrin rich clots and cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. This helps eliminate blood clots or arterial blockages that cause myocardial infarction.
Mechanism of Action Tenecteplase binds to fibrin rich clots via the fibronectin finger-like domain and the Kringle 2 domain. The protease domain then cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 99 - 119 mL/min [acute myocardial infarction patients]
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Additive anticoagulant/antiplatelet effects may increase bleed risk, so Ginkgo biloba's (DB01381) concomitant therapy should be avoided.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Intracranial or intraspinal surgery or trauma within 2 months
Side Effects Sudden numbness or weakness, problems with speech or balance, vision problems; little or no urinating; unexplained muscle pain.
Useful Link N.A.
PubMed ID 16488800, 16380055, 16084152, 15744554, 15650539
3-D Structure Th1028 (View) or (Download)

Entry 4
(4) Primary information
ID 1213
ThPP ID Th1028
Therapeutic Peptide/Protein Name Tenecteplase
Sequence SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS view full sequnce in fasta
Functional Classification Ib
Molecular Weight 58951.2
Chemical Formula C2561H3919N747O781S40
Isoelectric Point 7.61
Hydrophobicity -0.528
Melting Point (℃) 60
Half Life 1.9 hours (mammalian reticulocytes, in vitro)
Description Tenecteplase(527 amino acid) is a glycoprotein developed by introducing the following modifications to the complementary DNA for natural human tPA: a substitution of threonine 103 with asparagine, and a substitution of asparagine 117 with glutamine, both within the kringle 1 domain, and a tetra-alanine substitution at amino acids 296-299 in the protease domain.
Indication/Disease To treat myocardial infarction and lysis of intracoronary emboli.
Pharmacodynamics Tenecteplase is a fibrin-specific tissue-plasminogen activator. It binds to fibrin rich clots and cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. This helps eliminate blood clots or arterial blockages that cause myocardial infarction.
Mechanism of Action Tenecteplase binds to fibrin rich clots via the fibronectin finger-like domain and the Kringle 2 domain. The protease domain then cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 99 - 119 mL/min [acute myocardial infarction patients]
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Ginseng increases risk of bleeding.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Arteriovenous malformation or aneurysm
Side Effects Muscle weakness or loss of function, loss of bowel or bladder control; or severe pain in your upper stomach spreading to your back.
Useful Link N.A.
PubMed ID 16488800, 16380055, 16084152, 15744554, 15650539
3-D Structure Th1028 (View) or (Download)

Entry 5
(5) Primary information
ID 1214
ThPP ID Th1028
Therapeutic Peptide/Protein Name Tenecteplase
Sequence SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS view full sequnce in fasta
Functional Classification Ib
Molecular Weight 58951.2
Chemical Formula C2561H3919N747O781S40
Isoelectric Point 7.61
Hydrophobicity -0.528
Melting Point (℃) 60
Half Life 1.9 hours (mammalian reticulocytes, in vitro)
Description Tenecteplase(527 amino acid) is a glycoprotein developed by introducing the following modifications to the complementary DNA for natural human tPA: a substitution of threonine 103 with asparagine, and a substitution of asparagine 117 with glutamine, both within the kringle 1 domain, and a tetra-alanine substitution at amino acids 296-299 in the protease domain.
Indication/Disease To treat myocardial infarction and lysis of intracoronary emboli.
Pharmacodynamics Tenecteplase is a fibrin-specific tissue-plasminogen activator. It binds to fibrin rich clots and cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. This helps eliminate blood clots or arterial blockages that cause myocardial infarction.
Mechanism of Action Tenecteplase binds to fibrin rich clots via the fibronectin finger-like domain and the Kringle 2 domain. The protease domain then cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance 99 - 119 mL/min [acute myocardial infarction patients]
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Ticlopidine increases bleeding risk. Monitor for signs of bleeding.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Severe uncontrolled hypertension
Side Effects Tenderness, or weakness especially if you also have fever, unusual tiredness, and dark colored urine.
Useful Link N.A.
PubMed ID 16488800, 16380055, 16084152, 15744554, 15650539
3-D Structure Th1028 (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

(1) Primary information
Entry 1
ID	1210
ThPP ID	Th1028
Therapeutic Peptide/Protein Name	Tenecteplase
Sequence	SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	58951.2
Chemical Formula	C2561H3919N747O781S40
Isoelectric Point	7.61
Hydrophobicity	-0.528
Melting Point (℃)	60
Half Life	1.9 hours (mammalian reticulocytes, in vitro)
Description	Tenecteplase(527 amino acid) is a glycoprotein developed by introducing the following modifications to the complementary DNA for natural human tPA: a substitution of threonine 103 with asparagine, and a substitution of asparagine 117 with glutamine, both within the kringle 1 domain, and a tetra-alanine substitution at amino acids 296-299 in the protease domain.
Indication/Disease	To treat myocardial infarction and lysis of intracoronary emboli.
Pharmacodynamics	Tenecteplase is a fibrin-specific tissue-plasminogen activator. It binds to fibrin rich clots and cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. This helps eliminate blood clots or arterial blockages that cause myocardial infarction.
Mechanism of Action	Tenecteplase binds to fibrin rich clots via the fibronectin finger-like domain and the Kringle 2 domain. The protease domain then cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	99 - 119 mL/min [acute myocardial infarction patients]
Categories	Fibrinolytic Agents
Patents Number	CA2129660
Date of Issue	28/06/05
Date of Expiry	28/05/13
Drug Interaction	Aprotonin may antagonize the effect of Tenecteplase. Monitor for decreased effects of Tenecteplase.
Target	Plasminogen,Fibrinogen alpha chain,Urokinase plasminogen activator surface receptor,Plasminogen activator inhibitor 1,Plasminogen activator inhibitor 2,Tetranectin,Keratin, type II cytoskeletal 8,Annexin A2,Calreticulin,Calnexin,Prolow-density lipoprotein
Information of corresponding available drug in the market
Brand Name	TNKase
Company	Genentech Inc
Brand Discription	TNKase is a tissue plasminogen activator produced by recombinant DNA technology using an established mammalian cell line of Chinese Hamster Ovary cells. Tenecteplase(527 amino acid) is a glycoprotein developed by introducing the following modifications to
Prescribed for	To prevent death from a heart attack (acute myocardial infarction).
Chemical Name	N.A.
Formulation	Each vial of TNKase nominally contains 52.5 mg Tenecteplase, 0.55 g L-arginine, 0.17 g phosphoric acid, and 4.3 mg polysorbate 20, which includes a 5% overfill. Each vial will deliver 50 mg of Tenecteplase.
Physcial Appearance	Sterile, white to off-white, lyophilized powder
Route of Administration	Intravenous Injection
Recommended Dosage	The recommended total dose should not exceed 50 mg and is based upon patient weight. For less than 60 kg of body weight recommended dose is 30 mg of TNKase. Similarly 35 mg for 60-70 kg, 40 mg for 70-80 kg, 45 mg for 80-90 kg and 50 mg for more than 90 kg.
Contraindication	Active internal bleeding, History of cerebrovascular accident
Side Effects	Nausea, vomiting; or fever.
Useful Link	http://www.drugs.com/mtm/tnkase.html
PubMed ID	16488800, 16380055, 16084152, 15744554, 15650539
3-D Structure	Th1028 (View) or (Download)

(2) Primary information
Entry 2
ID	1211
ThPP ID	Th1028
Therapeutic Peptide/Protein Name	Tenecteplase
Sequence	SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	58951.2
Chemical Formula	C2561H3919N747O781S40
Isoelectric Point	7.61
Hydrophobicity	-0.528
Melting Point (℃)	60
Half Life	1.9 hours (mammalian reticulocytes, in vitro)
Description	Tenecteplase(527 amino acid) is a glycoprotein developed by introducing the following modifications to the complementary DNA for natural human tPA: a substitution of threonine 103 with asparagine, and a substitution of asparagine 117 with glutamine, both within the kringle 1 domain, and a tetra-alanine substitution at amino acids 296-299 in the protease domain.
Indication/Disease	To treat myocardial infarction and lysis of intracoronary emboli.
Pharmacodynamics	Tenecteplase is a fibrin-specific tissue-plasminogen activator. It binds to fibrin rich clots and cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. This helps eliminate blood clots or arterial blockages that cause myocardial infarction.
Mechanism of Action	Tenecteplase binds to fibrin rich clots via the fibronectin finger-like domain and the Kringle 2 domain. The protease domain then cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	99 - 119 mL/min [acute myocardial infarction patients]
Categories	Thrombolytic Agents
Patents Number	CA1341432
Date of Issue	17/06/03
Date of Expiry	17/06/20
Drug Interaction	Drotrecogin alfa increases risk of bleeding.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Intracranial neoplasm, Known bleeding diathesis
Side Effects	Chest pain, slow or uneven heartbeats; pain, swelling, hot or cold feeling, skin changes, or discoloration anywhere on your body; sudden leg or foot pain, foot ulcer, purple toes or fingers; swelling or severe pain or signs of infection in your fingers.
Useful Link	http://www.rxlist.com/tnkase-drug.htm
PubMed ID	16488800, 16380055, 16084152, 15744554, 15650539
3-D Structure	Th1028 (View) or (Download)

(3) Primary information
Entry 3
ID	1212
ThPP ID	Th1028
Therapeutic Peptide/Protein Name	Tenecteplase
Sequence	SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	58951.2
Chemical Formula	C2561H3919N747O781S40
Isoelectric Point	7.61
Hydrophobicity	-0.528
Melting Point (℃)	60
Half Life	1.9 hours (mammalian reticulocytes, in vitro)
Description	Tenecteplase(527 amino acid) is a glycoprotein developed by introducing the following modifications to the complementary DNA for natural human tPA: a substitution of threonine 103 with asparagine, and a substitution of asparagine 117 with glutamine, both within the kringle 1 domain, and a tetra-alanine substitution at amino acids 296-299 in the protease domain.
Indication/Disease	To treat myocardial infarction and lysis of intracoronary emboli.
Pharmacodynamics	Tenecteplase is a fibrin-specific tissue-plasminogen activator. It binds to fibrin rich clots and cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. This helps eliminate blood clots or arterial blockages that cause myocardial infarction.
Mechanism of Action	Tenecteplase binds to fibrin rich clots via the fibronectin finger-like domain and the Kringle 2 domain. The protease domain then cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	99 - 119 mL/min [acute myocardial infarction patients]
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Additive anticoagulant/antiplatelet effects may increase bleed risk, so Ginkgo biloba's (DB01381) concomitant therapy should be avoided.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Intracranial or intraspinal surgery or trauma within 2 months
Side Effects	Sudden numbness or weakness, problems with speech or balance, vision problems; little or no urinating; unexplained muscle pain.
Useful Link	N.A.
PubMed ID	16488800, 16380055, 16084152, 15744554, 15650539
3-D Structure	Th1028 (View) or (Download)

(4) Primary information
Entry 4
ID	1213
ThPP ID	Th1028
Therapeutic Peptide/Protein Name	Tenecteplase
Sequence	SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	58951.2
Chemical Formula	C2561H3919N747O781S40
Isoelectric Point	7.61
Hydrophobicity	-0.528
Melting Point (℃)	60
Half Life	1.9 hours (mammalian reticulocytes, in vitro)
Description	Tenecteplase(527 amino acid) is a glycoprotein developed by introducing the following modifications to the complementary DNA for natural human tPA: a substitution of threonine 103 with asparagine, and a substitution of asparagine 117 with glutamine, both within the kringle 1 domain, and a tetra-alanine substitution at amino acids 296-299 in the protease domain.
Indication/Disease	To treat myocardial infarction and lysis of intracoronary emboli.
Pharmacodynamics	Tenecteplase is a fibrin-specific tissue-plasminogen activator. It binds to fibrin rich clots and cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. This helps eliminate blood clots or arterial blockages that cause myocardial infarction.
Mechanism of Action	Tenecteplase binds to fibrin rich clots via the fibronectin finger-like domain and the Kringle 2 domain. The protease domain then cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	99 - 119 mL/min [acute myocardial infarction patients]
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Ginseng increases risk of bleeding.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Arteriovenous malformation or aneurysm
Side Effects	Muscle weakness or loss of function, loss of bowel or bladder control; or severe pain in your upper stomach spreading to your back.
Useful Link	N.A.
PubMed ID	16488800, 16380055, 16084152, 15744554, 15650539
3-D Structure	Th1028 (View) or (Download)

(5) Primary information
Entry 5
ID	1214
ThPP ID	Th1028
Therapeutic Peptide/Protein Name	Tenecteplase
Sequence	SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	58951.2
Chemical Formula	C2561H3919N747O781S40
Isoelectric Point	7.61
Hydrophobicity	-0.528
Melting Point (℃)	60
Half Life	1.9 hours (mammalian reticulocytes, in vitro)
Description	Tenecteplase(527 amino acid) is a glycoprotein developed by introducing the following modifications to the complementary DNA for natural human tPA: a substitution of threonine 103 with asparagine, and a substitution of asparagine 117 with glutamine, both within the kringle 1 domain, and a tetra-alanine substitution at amino acids 296-299 in the protease domain.
Indication/Disease	To treat myocardial infarction and lysis of intracoronary emboli.
Pharmacodynamics	Tenecteplase is a fibrin-specific tissue-plasminogen activator. It binds to fibrin rich clots and cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. This helps eliminate blood clots or arterial blockages that cause myocardial infarction.
Mechanism of Action	Tenecteplase binds to fibrin rich clots via the fibronectin finger-like domain and the Kringle 2 domain. The protease domain then cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	99 - 119 mL/min [acute myocardial infarction patients]
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Ticlopidine increases bleeding risk. Monitor for signs of bleeding.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Severe uncontrolled hypertension
Side Effects	Tenderness, or weakness especially if you also have fever, unusual tiredness, and dark colored urine.
Useful Link	N.A.
PubMed ID	16488800, 16380055, 16084152, 15744554, 15650539
3-D Structure	Th1028 (View) or (Download)