Detailed description page of THPdb

Details of Th1034 which contains 6 entries.

Entry 1
(1) Primary information
ID 1246
ThPP ID Th1034
Therapeutic Peptide/Protein Name Palifermin
Sequence SYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 16192.7
Chemical Formula C721H1142N202O204S9
Isoelectric Point 9.47
Hydrophobicity -0.65
Melting Point (℃) N.A.
Half Life N.A.
Description Palifermin(140 residues) is a recombinant human keratinocyte growth factor (KGF) produced using E. coli.
Indication/Disease For treatment of oral mucositis associated with chemotherapy and radiation therapy.
Pharmacodynamics Used in the prevention or treatment of oral mucoscitis (mouth ulcers arising from chemotherapy), Kepivance binds to the human keratinocyte growth factor (KGF) receptor on buccal cell surfaces. Kepivance acts as both a cell growth and survival factor by stimulating epithelial cell proliferation, differentiation, and migration around the tongue and mouth. The KGF receptor is found on many tissues particularly around the tongue, esophagus, salivary gland and other gastro-intestinal tract organs.
Mechanism of Action Kepivance binds to the human keratinocyte growth factor (KGF) receptor found on buccal cell surfaces. The binding activates a Ras-MapK (Map kinase) signaling pathway which leads to the transcriptional activation of many proteins important for cell growth and survival.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Anti-Mucositis Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Increases toxicity of bendamustine. Should not be administered within a 24 hour time period of antineoplastic agent administration.
Target Fibroblast growth factor receptor 2,Neuropilin-1,Fibroblast growth factor receptor 1,Fibroblast growth factor receptor 4,Fibroblast growth factor receptor 3,Basement membrane-specific heparan sulfate proteoglycan core protein
Information of corresponding available drug in the market
Brand Name Kepivance
Company Amgen Inc
Brand Discription Kepivance is a manmade form of a human protein that affects growth of cells within the tissues lining your mouth and digestive tract (esophagus, stomach, and intestines).
Prescribed for Kepivance is used to help prevent or heal mouth sores and ulcers in people being treated with chemotherapy and stem cell treatment. It is used in people receiving chemotherapy to treat blood cancers (Hodgkin's disease, multiple myeloma, leukemia).
Chemical Name N.A.
Formulation N.A.
Physcial Appearance Sterile, lyophilized powder
Route of Administration Intravenous infusion
Recommended Dosage The recommended dose of Kepivance is 60 mcg/kg/day, administered as an intravenous bolus injection for 3 consecutive days before and 3 consecutive days after myelotoxic therapy, for a total of 6 doses.
Contraindication N.A.
Side Effects Fever; swelling or redness of your skin; itching or rash; changes in your sense of taste or sense of touch; unusual or unpleasant sensations in your mouth; numbness in or around your mouth; joint pain; or discolored or thickened tongue.
Useful Link http://www.fda.gov/Drugs/DrugSafety/PostmarketDrugSafetyInformationforPatientsandProviders/ucm110263.htm
PubMed ID 25270293, 16179960, 28234746, 28093295, 27942550, 27090960, 27034762, 26968792, 26862696
3-D Structure Th1034 (View) or (Download)

Entry 2
(2) Primary information
ID 1247
ThPP ID Th1034
Therapeutic Peptide/Protein Name Palifermin
Sequence SYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 16192.7
Chemical Formula C721H1142N202O204S9
Isoelectric Point 9.47
Hydrophobicity -0.65
Melting Point (℃) N.A.
Half Life N.A.
Description Palifermin(140 residues) is a recombinant human keratinocyte growth factor (KGF) produced using E. coli.
Indication/Disease For treatment of oral mucositis associated with chemotherapy and radiation therapy.
Pharmacodynamics Used in the prevention or treatment of oral mucoscitis (mouth ulcers arising from chemotherapy), Kepivance binds to the human keratinocyte growth factor (KGF) receptor on buccal cell surfaces. Kepivance acts as both a cell growth and survival factor by stimulating epithelial cell proliferation, differentiation, and migration around the tongue and mouth. The KGF receptor is found on many tissues particularly around the tongue, esophagus, salivary gland and other gastro-intestinal tract organs.
Mechanism of Action Kepivance binds to the human keratinocyte growth factor (KGF) receptor found on buccal cell surfaces. The binding activates a Ras-MapK (Map kinase) signaling pathway which leads to the transcriptional activation of many proteins important for cell growth and survival.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Anti-Mucositis Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Increases the toxicity of pralatrexate. Avoid concomitant therapy or do not use palifermin within 24 hours after administration of pralatrexate.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.drugs.com/drug-interactions/palifermin,kepivance.html
PubMed ID 25270293, 16179960, 28234746, 28093295, 27942550, 27090960, 27034762, 26968792, 26862696
3-D Structure Th1034 (View) or (Download)

Entry 3
(3) Primary information
ID 1248
ThPP ID Th1034
Therapeutic Peptide/Protein Name Palifermin
Sequence SYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 16192.7
Chemical Formula C721H1142N202O204S9
Isoelectric Point 9.47
Hydrophobicity -0.65
Melting Point (℃) N.A.
Half Life N.A.
Description Palifermin(140 residues) is a recombinant human keratinocyte growth factor (KGF) produced using E. coli.
Indication/Disease For treatment of oral mucositis associated with chemotherapy and radiation therapy.
Pharmacodynamics Used in the prevention or treatment of oral mucoscitis (mouth ulcers arising from chemotherapy), Kepivance binds to the human keratinocyte growth factor (KGF) receptor on buccal cell surfaces. Kepivance acts as both a cell growth and survival factor by stimulating epithelial cell proliferation, differentiation, and migration around the tongue and mouth. The KGF receptor is found on many tissues particularly around the tongue, esophagus, salivary gland and other gastro-intestinal tract organs.
Mechanism of Action Kepivance binds to the human keratinocyte growth factor (KGF) receptor found on buccal cell surfaces. The binding activates a Ras-MapK (Map kinase) signaling pathway which leads to the transcriptional activation of many proteins important for cell growth and survival.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Anti-Mucositis Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.drugs.com/kepivance.html
PubMed ID 25270293, 16179960, 28234746, 28093295, 27942550, 27090960, 27034762, 26968792, 26862696
3-D Structure Th1034 (View) or (Download)

Entry 4
(4) Primary information
ID 1249
ThPP ID Th1034
Therapeutic Peptide/Protein Name Palifermin
Sequence SYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 16192.7
Chemical Formula C721H1142N202O204S9
Isoelectric Point 9.47
Hydrophobicity -0.65
Melting Point (℃) N.A.
Half Life N.A.
Description Palifermin(140 residues) is a recombinant human keratinocyte growth factor (KGF) produced using E. coli.
Indication/Disease For treatment of oral mucositis associated with chemotherapy and radiation therapy.
Pharmacodynamics Used in the prevention or treatment of oral mucoscitis (mouth ulcers arising from chemotherapy), Kepivance binds to the human keratinocyte growth factor (KGF) receptor on buccal cell surfaces. Kepivance acts as both a cell growth and survival factor by stimulating epithelial cell proliferation, differentiation, and migration around the tongue and mouth. The KGF receptor is found on many tissues particularly around the tongue, esophagus, salivary gland and other gastro-intestinal tract organs.
Mechanism of Action Kepivance binds to the human keratinocyte growth factor (KGF) receptor found on buccal cell surfaces. The binding activates a Ras-MapK (Map kinase) signaling pathway which leads to the transcriptional activation of many proteins important for cell growth and survival.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Anti-Mucositis Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.kepivance.com/patient
PubMed ID 25270293, 16179960, 28234746, 28093295, 27942550, 27090960, 27034762, 26968792, 26862696
3-D Structure Th1034 (View) or (Download)

Entry 5
(5) Primary information
ID 1250
ThPP ID Th1034
Therapeutic Peptide/Protein Name Palifermin
Sequence SYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 16192.7
Chemical Formula C721H1142N202O204S9
Isoelectric Point 9.47
Hydrophobicity -0.65
Melting Point (℃) N.A.
Half Life N.A.
Description Palifermin(140 residues) is a recombinant human keratinocyte growth factor (KGF) produced using E. coli.
Indication/Disease For treatment of oral mucositis associated with chemotherapy and radiation therapy.
Pharmacodynamics Used in the prevention or treatment of oral mucoscitis (mouth ulcers arising from chemotherapy), Kepivance binds to the human keratinocyte growth factor (KGF) receptor on buccal cell surfaces. Kepivance acts as both a cell growth and survival factor by stimulating epithelial cell proliferation, differentiation, and migration around the tongue and mouth. The KGF receptor is found on many tissues particularly around the tongue, esophagus, salivary gland and other gastro-intestinal tract organs.
Mechanism of Action Kepivance binds to the human keratinocyte growth factor (KGF) receptor found on buccal cell surfaces. The binding activates a Ras-MapK (Map kinase) signaling pathway which leads to the transcriptional activation of many proteins important for cell growth and survival.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Anti-Mucositis Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 25270293, 16179960, 28234746, 28093295, 27942550, 27090960, 27034762, 26968792, 26862696
3-D Structure Th1034 (View) or (Download)

Entry 6
(6) Primary information
ID 1251
ThPP ID Th1034
Therapeutic Peptide/Protein Name Palifermin
Sequence SYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVA view full sequnce in fasta
Functional Classification Ib
Molecular Weight 16192.7
Chemical Formula C721H1142N202O204S9
Isoelectric Point 9.47
Hydrophobicity -0.65
Melting Point (℃) N.A.
Half Life N.A.
Description Palifermin(140 residues) is a recombinant human keratinocyte growth factor (KGF) produced using E. coli.
Indication/Disease For treatment of oral mucositis associated with chemotherapy and radiation therapy.
Pharmacodynamics Used in the prevention or treatment of oral mucoscitis (mouth ulcers arising from chemotherapy), Kepivance binds to the human keratinocyte growth factor (KGF) receptor on buccal cell surfaces. Kepivance acts as both a cell growth and survival factor by stimulating epithelial cell proliferation, differentiation, and migration around the tongue and mouth. The KGF receptor is found on many tissues particularly around the tongue, esophagus, salivary gland and other gastro-intestinal tract organs.
Mechanism of Action Kepivance binds to the human keratinocyte growth factor (KGF) receptor found on buccal cell surfaces. The binding activates a Ras-MapK (Map kinase) signaling pathway which leads to the transcriptional activation of many proteins important for cell growth and survival.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Anti-Mucositis Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 25270293, 16179960, 28234746, 28093295, 27942550, 27090960, 27034762, 26968792, 26862696
3-D Structure Th1034 (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

(1) Primary information
Entry 1
ID	1246
ThPP ID	Th1034
Therapeutic Peptide/Protein Name	Palifermin
Sequence	SYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	16192.7
Chemical Formula	C721H1142N202O204S9
Isoelectric Point	9.47
Hydrophobicity	-0.65
Melting Point (℃)	N.A.
Half Life	N.A.
Description	Palifermin(140 residues) is a recombinant human keratinocyte growth factor (KGF) produced using E. coli.
Indication/Disease	For treatment of oral mucositis associated with chemotherapy and radiation therapy.
Pharmacodynamics	Used in the prevention or treatment of oral mucoscitis (mouth ulcers arising from chemotherapy), Kepivance binds to the human keratinocyte growth factor (KGF) receptor on buccal cell surfaces. Kepivance acts as both a cell growth and survival factor by stimulating epithelial cell proliferation, differentiation, and migration around the tongue and mouth. The KGF receptor is found on many tissues particularly around the tongue, esophagus, salivary gland and other gastro-intestinal tract organs.
Mechanism of Action	Kepivance binds to the human keratinocyte growth factor (KGF) receptor found on buccal cell surfaces. The binding activates a Ras-MapK (Map kinase) signaling pathway which leads to the transcriptional activation of many proteins important for cell growth and survival.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Anti-Mucositis Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Increases toxicity of bendamustine. Should not be administered within a 24 hour time period of antineoplastic agent administration.
Target	Fibroblast growth factor receptor 2,Neuropilin-1,Fibroblast growth factor receptor 1,Fibroblast growth factor receptor 4,Fibroblast growth factor receptor 3,Basement membrane-specific heparan sulfate proteoglycan core protein
Information of corresponding available drug in the market
Brand Name	Kepivance
Company	Amgen Inc
Brand Discription	Kepivance is a manmade form of a human protein that affects growth of cells within the tissues lining your mouth and digestive tract (esophagus, stomach, and intestines).
Prescribed for	Kepivance is used to help prevent or heal mouth sores and ulcers in people being treated with chemotherapy and stem cell treatment. It is used in people receiving chemotherapy to treat blood cancers (Hodgkin's disease, multiple myeloma, leukemia).
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	Sterile, lyophilized powder
Route of Administration	Intravenous infusion
Recommended Dosage	The recommended dose of Kepivance is 60 mcg/kg/day, administered as an intravenous bolus injection for 3 consecutive days before and 3 consecutive days after myelotoxic therapy, for a total of 6 doses.
Contraindication	N.A.
Side Effects	Fever; swelling or redness of your skin; itching or rash; changes in your sense of taste or sense of touch; unusual or unpleasant sensations in your mouth; numbness in or around your mouth; joint pain; or discolored or thickened tongue.
Useful Link	http://www.fda.gov/Drugs/DrugSafety/PostmarketDrugSafetyInformationforPatientsandProviders/ucm110263.htm
PubMed ID	25270293, 16179960, 28234746, 28093295, 27942550, 27090960, 27034762, 26968792, 26862696
3-D Structure	Th1034 (View) or (Download)

(2) Primary information
Entry 2
ID	1247
ThPP ID	Th1034
Therapeutic Peptide/Protein Name	Palifermin
Sequence	SYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	16192.7
Chemical Formula	C721H1142N202O204S9
Isoelectric Point	9.47
Hydrophobicity	-0.65
Melting Point (℃)	N.A.
Half Life	N.A.
Description	Palifermin(140 residues) is a recombinant human keratinocyte growth factor (KGF) produced using E. coli.
Indication/Disease	For treatment of oral mucositis associated with chemotherapy and radiation therapy.
Pharmacodynamics	Used in the prevention or treatment of oral mucoscitis (mouth ulcers arising from chemotherapy), Kepivance binds to the human keratinocyte growth factor (KGF) receptor on buccal cell surfaces. Kepivance acts as both a cell growth and survival factor by stimulating epithelial cell proliferation, differentiation, and migration around the tongue and mouth. The KGF receptor is found on many tissues particularly around the tongue, esophagus, salivary gland and other gastro-intestinal tract organs.
Mechanism of Action	Kepivance binds to the human keratinocyte growth factor (KGF) receptor found on buccal cell surfaces. The binding activates a Ras-MapK (Map kinase) signaling pathway which leads to the transcriptional activation of many proteins important for cell growth and survival.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Anti-Mucositis Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Increases the toxicity of pralatrexate. Avoid concomitant therapy or do not use palifermin within 24 hours after administration of pralatrexate.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.drugs.com/drug-interactions/palifermin,kepivance.html
PubMed ID	25270293, 16179960, 28234746, 28093295, 27942550, 27090960, 27034762, 26968792, 26862696
3-D Structure	Th1034 (View) or (Download)

(3) Primary information
Entry 3
ID	1248
ThPP ID	Th1034
Therapeutic Peptide/Protein Name	Palifermin
Sequence	SYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	16192.7
Chemical Formula	C721H1142N202O204S9
Isoelectric Point	9.47
Hydrophobicity	-0.65
Melting Point (℃)	N.A.
Half Life	N.A.
Description	Palifermin(140 residues) is a recombinant human keratinocyte growth factor (KGF) produced using E. coli.
Indication/Disease	For treatment of oral mucositis associated with chemotherapy and radiation therapy.
Pharmacodynamics	Used in the prevention or treatment of oral mucoscitis (mouth ulcers arising from chemotherapy), Kepivance binds to the human keratinocyte growth factor (KGF) receptor on buccal cell surfaces. Kepivance acts as both a cell growth and survival factor by stimulating epithelial cell proliferation, differentiation, and migration around the tongue and mouth. The KGF receptor is found on many tissues particularly around the tongue, esophagus, salivary gland and other gastro-intestinal tract organs.
Mechanism of Action	Kepivance binds to the human keratinocyte growth factor (KGF) receptor found on buccal cell surfaces. The binding activates a Ras-MapK (Map kinase) signaling pathway which leads to the transcriptional activation of many proteins important for cell growth and survival.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Anti-Mucositis Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.drugs.com/kepivance.html
PubMed ID	25270293, 16179960, 28234746, 28093295, 27942550, 27090960, 27034762, 26968792, 26862696
3-D Structure	Th1034 (View) or (Download)

(4) Primary information
Entry 4
ID	1249
ThPP ID	Th1034
Therapeutic Peptide/Protein Name	Palifermin
Sequence	SYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	16192.7
Chemical Formula	C721H1142N202O204S9
Isoelectric Point	9.47
Hydrophobicity	-0.65
Melting Point (℃)	N.A.
Half Life	N.A.
Description	Palifermin(140 residues) is a recombinant human keratinocyte growth factor (KGF) produced using E. coli.
Indication/Disease	For treatment of oral mucositis associated with chemotherapy and radiation therapy.
Pharmacodynamics	Used in the prevention or treatment of oral mucoscitis (mouth ulcers arising from chemotherapy), Kepivance binds to the human keratinocyte growth factor (KGF) receptor on buccal cell surfaces. Kepivance acts as both a cell growth and survival factor by stimulating epithelial cell proliferation, differentiation, and migration around the tongue and mouth. The KGF receptor is found on many tissues particularly around the tongue, esophagus, salivary gland and other gastro-intestinal tract organs.
Mechanism of Action	Kepivance binds to the human keratinocyte growth factor (KGF) receptor found on buccal cell surfaces. The binding activates a Ras-MapK (Map kinase) signaling pathway which leads to the transcriptional activation of many proteins important for cell growth and survival.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Anti-Mucositis Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.kepivance.com/patient
PubMed ID	25270293, 16179960, 28234746, 28093295, 27942550, 27090960, 27034762, 26968792, 26862696
3-D Structure	Th1034 (View) or (Download)

(5) Primary information
Entry 5
ID	1250
ThPP ID	Th1034
Therapeutic Peptide/Protein Name	Palifermin
Sequence	SYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	16192.7
Chemical Formula	C721H1142N202O204S9
Isoelectric Point	9.47
Hydrophobicity	-0.65
Melting Point (℃)	N.A.
Half Life	N.A.
Description	Palifermin(140 residues) is a recombinant human keratinocyte growth factor (KGF) produced using E. coli.
Indication/Disease	For treatment of oral mucositis associated with chemotherapy and radiation therapy.
Pharmacodynamics	Used in the prevention or treatment of oral mucoscitis (mouth ulcers arising from chemotherapy), Kepivance binds to the human keratinocyte growth factor (KGF) receptor on buccal cell surfaces. Kepivance acts as both a cell growth and survival factor by stimulating epithelial cell proliferation, differentiation, and migration around the tongue and mouth. The KGF receptor is found on many tissues particularly around the tongue, esophagus, salivary gland and other gastro-intestinal tract organs.
Mechanism of Action	Kepivance binds to the human keratinocyte growth factor (KGF) receptor found on buccal cell surfaces. The binding activates a Ras-MapK (Map kinase) signaling pathway which leads to the transcriptional activation of many proteins important for cell growth and survival.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Anti-Mucositis Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	25270293, 16179960, 28234746, 28093295, 27942550, 27090960, 27034762, 26968792, 26862696
3-D Structure	Th1034 (View) or (Download)

(6) Primary information
Entry 6
ID	1251
ThPP ID	Th1034
Therapeutic Peptide/Protein Name	Palifermin
Sequence	SYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVA view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	16192.7
Chemical Formula	C721H1142N202O204S9
Isoelectric Point	9.47
Hydrophobicity	-0.65
Melting Point (℃)	N.A.
Half Life	N.A.
Description	Palifermin(140 residues) is a recombinant human keratinocyte growth factor (KGF) produced using E. coli.
Indication/Disease	For treatment of oral mucositis associated with chemotherapy and radiation therapy.
Pharmacodynamics	Used in the prevention or treatment of oral mucoscitis (mouth ulcers arising from chemotherapy), Kepivance binds to the human keratinocyte growth factor (KGF) receptor on buccal cell surfaces. Kepivance acts as both a cell growth and survival factor by stimulating epithelial cell proliferation, differentiation, and migration around the tongue and mouth. The KGF receptor is found on many tissues particularly around the tongue, esophagus, salivary gland and other gastro-intestinal tract organs.
Mechanism of Action	Kepivance binds to the human keratinocyte growth factor (KGF) receptor found on buccal cell surfaces. The binding activates a Ras-MapK (Map kinase) signaling pathway which leads to the transcriptional activation of many proteins important for cell growth and survival.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Anti-Mucositis Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	25270293, 16179960, 28234746, 28093295, 27942550, 27090960, 27034762, 26968792, 26862696
3-D Structure	Th1034 (View) or (Download)