| Entry 1 |
| (1) Primary information |
|---|
| ID | 1246 |
| ThPP ID | Th1034 |
| Therapeutic Peptide/Protein Name | Palifermin |
| Sequence | SYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVA view full sequnce in fasta |
| Functional Classification | Ib |
| Molecular Weight | 16192.7 |
| Chemical Formula | C721H1142N202O204S9 |
| Isoelectric Point | 9.47 |
| Hydrophobicity | -0.65 |
| Melting Point (℃) | N.A. |
| Half Life | N.A. |
| Description | Palifermin(140 residues) is a recombinant human keratinocyte growth factor (KGF) produced using E. coli. |
| Indication/Disease | For treatment of oral mucositis associated with chemotherapy and radiation therapy. |
| Pharmacodynamics | Used in the prevention or treatment of oral mucoscitis (mouth ulcers arising from chemotherapy), Kepivance binds to the human keratinocyte growth factor (KGF) receptor on buccal cell surfaces. Kepivance acts as both a cell growth and survival factor by stimulating epithelial cell proliferation, differentiation, and migration around the tongue and mouth. The KGF receptor is found on many tissues particularly around the tongue, esophagus, salivary gland and other gastro-intestinal tract organs. |
| Mechanism of Action | Kepivance binds to the human keratinocyte growth factor (KGF) receptor found on buccal cell surfaces. The binding activates a Ras-MapK (Map kinase) signaling pathway which leads to the transcriptional activation of many proteins important for cell growth and survival. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Anti-Mucositis Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | Increases toxicity of bendamustine. Should not be administered within a 24 hour time period of antineoplastic agent administration. |
| Target | Fibroblast growth factor receptor 2,Neuropilin-1,Fibroblast growth factor receptor 1,Fibroblast growth factor receptor 4,Fibroblast growth factor receptor 3,Basement membrane-specific heparan sulfate proteoglycan core protein |
| Information of corresponding available drug in the market |
|---|
| Brand Name | Kepivance |
| Company | Amgen Inc |
| Brand Discription | Kepivance is a manmade form of a human protein that affects growth of cells within the tissues lining your mouth and digestive tract (esophagus, stomach, and intestines). |
| Prescribed for | Kepivance is used to help prevent or heal mouth sores and ulcers in people being treated with chemotherapy and stem cell treatment. It is used in people receiving chemotherapy to treat blood cancers (Hodgkin's disease, multiple myeloma, leukemia). |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | Sterile, lyophilized powder |
| Route of Administration | Intravenous infusion |
| Recommended Dosage | The recommended dose of Kepivance is 60 mcg/kg/day, administered as an intravenous bolus injection for 3 consecutive days before and 3 consecutive days after myelotoxic therapy, for a total of 6 doses. |
| Contraindication | N.A. |
| Side Effects | Fever; swelling or redness of your skin; itching or rash; changes in your sense of taste or sense of touch; unusual or unpleasant sensations in your mouth; numbness in or around your mouth; joint pain; or discolored or thickened tongue. |
| Useful Link | http://www.fda.gov/Drugs/DrugSafety/PostmarketDrugSafetyInformationforPatientsandProviders/ucm110263.htm |
| PubMed ID | 25270293, 16179960, 28234746, 28093295, 27942550, 27090960, 27034762, 26968792, 26862696 |
| 3-D Structure | Th1034 (View) or (Download) |
| Entry 2 |
| (2) Primary information |
|---|
| ID | 1247 |
| ThPP ID | Th1034 |
| Therapeutic Peptide/Protein Name | Palifermin |
| Sequence | SYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVA view full sequnce in fasta |
| Functional Classification | Ib |
| Molecular Weight | 16192.7 |
| Chemical Formula | C721H1142N202O204S9 |
| Isoelectric Point | 9.47 |
| Hydrophobicity | -0.65 |
| Melting Point (℃) | N.A. |
| Half Life | N.A. |
| Description | Palifermin(140 residues) is a recombinant human keratinocyte growth factor (KGF) produced using E. coli. |
| Indication/Disease | For treatment of oral mucositis associated with chemotherapy and radiation therapy. |
| Pharmacodynamics | Used in the prevention or treatment of oral mucoscitis (mouth ulcers arising from chemotherapy), Kepivance binds to the human keratinocyte growth factor (KGF) receptor on buccal cell surfaces. Kepivance acts as both a cell growth and survival factor by stimulating epithelial cell proliferation, differentiation, and migration around the tongue and mouth. The KGF receptor is found on many tissues particularly around the tongue, esophagus, salivary gland and other gastro-intestinal tract organs. |
| Mechanism of Action | Kepivance binds to the human keratinocyte growth factor (KGF) receptor found on buccal cell surfaces. The binding activates a Ras-MapK (Map kinase) signaling pathway which leads to the transcriptional activation of many proteins important for cell growth and survival. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Anti-Mucositis Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | Increases the toxicity of pralatrexate. Avoid concomitant therapy or do not use palifermin within 24 hours after administration of pralatrexate. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | http://www.drugs.com/drug-interactions/palifermin,kepivance.html |
| PubMed ID | 25270293, 16179960, 28234746, 28093295, 27942550, 27090960, 27034762, 26968792, 26862696 |
| 3-D Structure | Th1034 (View) or (Download) |
| Entry 3 |
| (3) Primary information |
|---|
| ID | 1248 |
| ThPP ID | Th1034 |
| Therapeutic Peptide/Protein Name | Palifermin |
| Sequence | SYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVA view full sequnce in fasta |
| Functional Classification | Ib |
| Molecular Weight | 16192.7 |
| Chemical Formula | C721H1142N202O204S9 |
| Isoelectric Point | 9.47 |
| Hydrophobicity | -0.65 |
| Melting Point (℃) | N.A. |
| Half Life | N.A. |
| Description | Palifermin(140 residues) is a recombinant human keratinocyte growth factor (KGF) produced using E. coli. |
| Indication/Disease | For treatment of oral mucositis associated with chemotherapy and radiation therapy. |
| Pharmacodynamics | Used in the prevention or treatment of oral mucoscitis (mouth ulcers arising from chemotherapy), Kepivance binds to the human keratinocyte growth factor (KGF) receptor on buccal cell surfaces. Kepivance acts as both a cell growth and survival factor by stimulating epithelial cell proliferation, differentiation, and migration around the tongue and mouth. The KGF receptor is found on many tissues particularly around the tongue, esophagus, salivary gland and other gastro-intestinal tract organs. |
| Mechanism of Action | Kepivance binds to the human keratinocyte growth factor (KGF) receptor found on buccal cell surfaces. The binding activates a Ras-MapK (Map kinase) signaling pathway which leads to the transcriptional activation of many proteins important for cell growth and survival. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Anti-Mucositis Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | http://www.drugs.com/kepivance.html |
| PubMed ID | 25270293, 16179960, 28234746, 28093295, 27942550, 27090960, 27034762, 26968792, 26862696 |
| 3-D Structure | Th1034 (View) or (Download) |
| Entry 4 |
| (4) Primary information |
|---|
| ID | 1249 |
| ThPP ID | Th1034 |
| Therapeutic Peptide/Protein Name | Palifermin |
| Sequence | SYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVA view full sequnce in fasta |
| Functional Classification | Ib |
| Molecular Weight | 16192.7 |
| Chemical Formula | C721H1142N202O204S9 |
| Isoelectric Point | 9.47 |
| Hydrophobicity | -0.65 |
| Melting Point (℃) | N.A. |
| Half Life | N.A. |
| Description | Palifermin(140 residues) is a recombinant human keratinocyte growth factor (KGF) produced using E. coli. |
| Indication/Disease | For treatment of oral mucositis associated with chemotherapy and radiation therapy. |
| Pharmacodynamics | Used in the prevention or treatment of oral mucoscitis (mouth ulcers arising from chemotherapy), Kepivance binds to the human keratinocyte growth factor (KGF) receptor on buccal cell surfaces. Kepivance acts as both a cell growth and survival factor by stimulating epithelial cell proliferation, differentiation, and migration around the tongue and mouth. The KGF receptor is found on many tissues particularly around the tongue, esophagus, salivary gland and other gastro-intestinal tract organs. |
| Mechanism of Action | Kepivance binds to the human keratinocyte growth factor (KGF) receptor found on buccal cell surfaces. The binding activates a Ras-MapK (Map kinase) signaling pathway which leads to the transcriptional activation of many proteins important for cell growth and survival. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Anti-Mucositis Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | http://www.kepivance.com/patient |
| PubMed ID | 25270293, 16179960, 28234746, 28093295, 27942550, 27090960, 27034762, 26968792, 26862696 |
| 3-D Structure | Th1034 (View) or (Download) |
| Entry 5 |
| (5) Primary information |
|---|
| ID | 1250 |
| ThPP ID | Th1034 |
| Therapeutic Peptide/Protein Name | Palifermin |
| Sequence | SYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVA view full sequnce in fasta |
| Functional Classification | Ib |
| Molecular Weight | 16192.7 |
| Chemical Formula | C721H1142N202O204S9 |
| Isoelectric Point | 9.47 |
| Hydrophobicity | -0.65 |
| Melting Point (℃) | N.A. |
| Half Life | N.A. |
| Description | Palifermin(140 residues) is a recombinant human keratinocyte growth factor (KGF) produced using E. coli. |
| Indication/Disease | For treatment of oral mucositis associated with chemotherapy and radiation therapy. |
| Pharmacodynamics | Used in the prevention or treatment of oral mucoscitis (mouth ulcers arising from chemotherapy), Kepivance binds to the human keratinocyte growth factor (KGF) receptor on buccal cell surfaces. Kepivance acts as both a cell growth and survival factor by stimulating epithelial cell proliferation, differentiation, and migration around the tongue and mouth. The KGF receptor is found on many tissues particularly around the tongue, esophagus, salivary gland and other gastro-intestinal tract organs. |
| Mechanism of Action | Kepivance binds to the human keratinocyte growth factor (KGF) receptor found on buccal cell surfaces. The binding activates a Ras-MapK (Map kinase) signaling pathway which leads to the transcriptional activation of many proteins important for cell growth and survival. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Anti-Mucositis Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | N.A. |
| PubMed ID | 25270293, 16179960, 28234746, 28093295, 27942550, 27090960, 27034762, 26968792, 26862696 |
| 3-D Structure | Th1034 (View) or (Download) |
| Entry 6 |
| (6) Primary information |
|---|
| ID | 1251 |
| ThPP ID | Th1034 |
| Therapeutic Peptide/Protein Name | Palifermin |
| Sequence | SYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVA view full sequnce in fasta |
| Functional Classification | Ib |
| Molecular Weight | 16192.7 |
| Chemical Formula | C721H1142N202O204S9 |
| Isoelectric Point | 9.47 |
| Hydrophobicity | -0.65 |
| Melting Point (℃) | N.A. |
| Half Life | N.A. |
| Description | Palifermin(140 residues) is a recombinant human keratinocyte growth factor (KGF) produced using E. coli. |
| Indication/Disease | For treatment of oral mucositis associated with chemotherapy and radiation therapy. |
| Pharmacodynamics | Used in the prevention or treatment of oral mucoscitis (mouth ulcers arising from chemotherapy), Kepivance binds to the human keratinocyte growth factor (KGF) receptor on buccal cell surfaces. Kepivance acts as both a cell growth and survival factor by stimulating epithelial cell proliferation, differentiation, and migration around the tongue and mouth. The KGF receptor is found on many tissues particularly around the tongue, esophagus, salivary gland and other gastro-intestinal tract organs. |
| Mechanism of Action | Kepivance binds to the human keratinocyte growth factor (KGF) receptor found on buccal cell surfaces. The binding activates a Ras-MapK (Map kinase) signaling pathway which leads to the transcriptional activation of many proteins important for cell growth and survival. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Anti-Mucositis Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | N.A. |
| PubMed ID | 25270293, 16179960, 28234746, 28093295, 27942550, 27090960, 27034762, 26968792, 26862696 |
| 3-D Structure | Th1034 (View) or (Download) |