Detailed description page of THPdb

Details of Th1037 which contains 5 entries.

Entry 1
(1) Primary information
ID 1260
ThPP ID Th1037
Therapeutic Peptide/Protein Name Botulinum Toxin Type B
Sequence MPVTINNFNYNDPIDNNNIIMMEPPFARGTGRYYKAFKITDRIWIIPERY view full sequnce in fasta
Functional Classification Ic
Molecular Weight 150804
Chemical Formula C690H1115N177O202S6
Isoelectric Point N.A.
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life N.A.
Description Neurotoxin produced by fermentation of clostridium botulinum type B. The protein exists in noncovalent association with hemagglutinin and nonhemagglutinin proteins as a neurotoxin complex. The neurotoxin complex is recovered from the fermentation process.
Indication/Disease To treat patients with cervical dystonia to reduce the severity of abnormal head position and neck pain associated with cervical dystonia.
Pharmacodynamics Botulinum Toxin Type B inhibits acetylcholine release at the neuromuscular junction via a three stage process: 1) Heavy Chain mediated neurospecific binding of the toxin, 2) internalization of the toxin by receptor-mediated endocytosis, and 3) ATP and pH dependent translocation of the Light Chain to the neuronal cytosol where it acts as a zinc-dependent endoprotease cleaving polypeptides essential for neurotransmitter release.
Mechanism of Action Botulinum Toxin Type B binds and cleaves the synaptic Vesicle Associated Membrane Protein (VAMP, also known as synaptobrevin) which is a component of the protein complex responsible for docking and fusion of the synaptic vesicle to the presynaptic membrane, a necessary step to neurotransmitter release.
Toxicity One unit of Botulinum Toxin Type B corresponds to the calculated median lethal intraperitoneal dose (LD50) in mice.
Metabolism N.A.
Absorption Botulinum Toxin Type B is not expected to be present in the peripheral blood at measurable levels following IM injection at the recommended doses as pharmacokinetic or ADME studies were not performed
Volume of Distribution N.A.
Clearance N.A.
Categories Antidystonic Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target Vesicle-associated membrane protein 2,Vesicle-associated membrane protein 1,Synaptotagmin-2
Information of corresponding available drug in the market
Brand Name Myobloc
Company Solstice Neurosciences
Brand Discription MYOBLOC injection is a sterile liquid formulation of a purified neurotoxin that acts at the neuromuscular junction to produce flaccid paralysis. The neurotoxin is produced by fermentation of the bacterium Clostridium botulinum type B (Bean strain) and exi
Prescribed for It is used for reducing the severity of abnormal head position and neck pain associated with a certain neck problem (cervical dystonia)
Chemical Name N.A.
Formulation It is supplied in 3.5-mL glass vials. Each single-use vial of formulated MYOBLOC contains 5,000 Units of botulinum toxin type B per milliliter in 0.05% human serum albumin, 0.01 M sodium succinate, and 0.1 M sodium chloride at approximately pH 5.6.
Physcial Appearance Clear and colorless to light-yellow Sterile injectable solution
Route of Administration Injection
Recommended Dosage The recommended initial dose of MYOBLOC (botulinum toxin type b) for patients with a prior history of tolerating botulinum toxin injections is 2,500 to 5,000 Units divided among affected muscles. Patients without a prior history of tolerating botulinum toxin injections should receive lower initial dose.
Contraindication MYOBLOC is contraindicated in patients with a known hypersensitivity to any botulinum toxin preparation or to any of the components in the formulation and in patients with infection at the proposed injection site
Side Effects Anxiety; back pain; dizziness; drowsiness; dry eyes; dry mouth; flu-like symptoms; headache; increased cough; indigestion; nausea; neck pain; pain, redness, swelling, or tenderness at the injection site; runny nose; sensitivity to light; sweating; upset stomach.
Useful Link http://www.rxlist.com/myobloc-drug.html
PubMed ID 10534247, 10534247
3-D Structure Th1037 (View) or (Download)

Entry 2
(2) Primary information
ID 1261
ThPP ID Th1037
Therapeutic Peptide/Protein Name Botulinum Toxin Type B
Sequence MPVTINNFNYNDPIDNNNIIMMEPPFARGTGRYYKAFKITDRIWIIPERY view full sequnce in fasta
Functional Classification Ic
Molecular Weight 150804
Chemical Formula C690H1115N177O202S6
Isoelectric Point N.A.
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life N.A.
Description Neurotoxin produced by fermentation of clostridium botulinum type B. The protein exists in noncovalent association with hemagglutinin and nonhemagglutinin proteins as a neurotoxin complex. The neurotoxin complex is recovered from the fermentation process.
Indication/Disease To treat patients with cervical dystonia to reduce the severity of abnormal head position and neck pain associated with cervical dystonia.
Pharmacodynamics Botulinum Toxin Type B inhibits acetylcholine release at the neuromuscular junction via a three stage process: 1) Heavy Chain mediated neurospecific binding of the toxin, 2) internalization of the toxin by receptor-mediated endocytosis, and 3) ATP and pH dependent translocation of the Light Chain to the neuronal cytosol where it acts as a zinc-dependent endoprotease cleaving polypeptides essential for neurotransmitter release.
Mechanism of Action Botulinum Toxin Type B binds and cleaves the synaptic Vesicle Associated Membrane Protein (VAMP, also known as synaptobrevin) which is a component of the protein complex responsible for docking and fusion of the synaptic vesicle to the presynaptic membrane, a necessary step to neurotransmitter release.
Toxicity One unit of Botulinum Toxin Type B corresponds to the calculated median lethal intraperitoneal dose (LD50) in mice.
Metabolism N.A.
Absorption Botulinum Toxin Type B is not expected to be present in the peripheral blood at measurable levels following IM injection at the recommended doses as pharmacokinetic or ADME studies were not performed
Volume of Distribution N.A.
Clearance N.A.
Categories Antidystonic Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Rash; hives; itching; difficulty breathing; tightness in the chest; swelling of the mouth, face, lips, or tongue; bleeding at the injection site; chest pain; difficulty swallowing or breathing; double or blurred vision, or other vision changes; drooping eyelids, hoarseness, change in or loss of voice; loss of bladder control; or trouble speaking, breathing, or swallowing.
Useful Link http://www.drugs.com/drug-interactions/botulinum-toxin-type-b,myobloc-index.html
PubMed ID 10534247, 10534247
3-D Structure Th1037 (View) or (Download)

Entry 3
(3) Primary information
ID 1262
ThPP ID Th1037
Therapeutic Peptide/Protein Name Botulinum Toxin Type B
Sequence MPVTINNFNYNDPIDNNNIIMMEPPFARGTGRYYKAFKITDRIWIIPERY view full sequnce in fasta
Functional Classification Ic
Molecular Weight 150804
Chemical Formula C690H1115N177O202S6
Isoelectric Point N.A.
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life N.A.
Description Neurotoxin produced by fermentation of clostridium botulinum type B. The protein exists in noncovalent association with hemagglutinin and nonhemagglutinin proteins as a neurotoxin complex. The neurotoxin complex is recovered from the fermentation process.
Indication/Disease To treat patients with cervical dystonia to reduce the severity of abnormal head position and neck pain associated with cervical dystonia.
Pharmacodynamics Botulinum Toxin Type B inhibits acetylcholine release at the neuromuscular junction via a three stage process: 1) Heavy Chain mediated neurospecific binding of the toxin, 2) internalization of the toxin by receptor-mediated endocytosis, and 3) ATP and pH dependent translocation of the Light Chain to the neuronal cytosol where it acts as a zinc-dependent endoprotease cleaving polypeptides essential for neurotransmitter release.
Mechanism of Action Botulinum Toxin Type B binds and cleaves the synaptic Vesicle Associated Membrane Protein (VAMP, also known as synaptobrevin) which is a component of the protein complex responsible for docking and fusion of the synaptic vesicle to the presynaptic membrane, a necessary step to neurotransmitter release.
Toxicity One unit of Botulinum Toxin Type B corresponds to the calculated median lethal intraperitoneal dose (LD50) in mice.
Metabolism N.A.
Absorption Botulinum Toxin Type B is not expected to be present in the peripheral blood at measurable levels following IM injection at the recommended doses as pharmacokinetic or ADME studies were not performed
Volume of Distribution N.A.
Clearance N.A.
Categories Antidystonic Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Seizures; severe or persistent muscle weakness or dizziness; shortness or breath; speech changes or problems; swelling of the hands or feet; vaginal irritation, odor, or discharge; wheezing.
Useful Link http://www.drugs.com/cdi/myobloc.html
PubMed ID 10534247, 10534247
3-D Structure Th1037 (View) or (Download)

Entry 4
(4) Primary information
ID 1263
ThPP ID Th1037
Therapeutic Peptide/Protein Name Botulinum Toxin Type B
Sequence MPVTINNFNYNDPIDNNNIIMMEPPFARGTGRYYKAFKITDRIWIIPERY view full sequnce in fasta
Functional Classification Ic
Molecular Weight 150804
Chemical Formula C690H1115N177O202S6
Isoelectric Point N.A.
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life N.A.
Description Neurotoxin produced by fermentation of clostridium botulinum type B. The protein exists in noncovalent association with hemagglutinin and nonhemagglutinin proteins as a neurotoxin complex. The neurotoxin complex is recovered from the fermentation process.
Indication/Disease To treat patients with cervical dystonia to reduce the severity of abnormal head position and neck pain associated with cervical dystonia.
Pharmacodynamics Botulinum Toxin Type B inhibits acetylcholine release at the neuromuscular junction via a three stage process: 1) Heavy Chain mediated neurospecific binding of the toxin, 2) internalization of the toxin by receptor-mediated endocytosis, and 3) ATP and pH dependent translocation of the Light Chain to the neuronal cytosol where it acts as a zinc-dependent endoprotease cleaving polypeptides essential for neurotransmitter release.
Mechanism of Action Botulinum Toxin Type B binds and cleaves the synaptic Vesicle Associated Membrane Protein (VAMP, also known as synaptobrevin) which is a component of the protein complex responsible for docking and fusion of the synaptic vesicle to the presynaptic membrane, a necessary step to neurotransmitter release.
Toxicity One unit of Botulinum Toxin Type B corresponds to the calculated median lethal intraperitoneal dose (LD50) in mice.
Metabolism N.A.
Absorption Botulinum Toxin Type B is not expected to be present in the peripheral blood at measurable levels following IM injection at the recommended doses as pharmacokinetic or ADME studies were not performed
Volume of Distribution N.A.
Clearance N.A.
Categories Antidystonic Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction The effect of administering different botulinum neurotoxin serotypes concurrently is unknown. However, in clinical studies, NeuroBloc was administered 16 weeks after the injection of Botulinum Toxin Type A. Co-administration of NeuroBloc and aminoglycos
Target N.A.
Information of corresponding available drug in the market
Brand Name Neurobloc
Company Solstice Neurosciences
Brand Discription Neurobloc is a medicine which is used in muscle spasm of the neck. Neurobloc contains botulinum toxin type b.
Prescribed for NeuroBloc is indicated for the treatment of cervical dystonia (torticollis) in adults. It means Neurobloc is used to treat muscle spasms of the neck
Chemical Name N.A.
Formulation Medicines contain active ingredients and may also contain other, additional ingredients that help ensure the stability, safety and effectiveness of the medicine. Some may be used to prolong the life of the medicine. Neurobloc contains botulinum toxin type
Physcial Appearance Clear and colourless to light yellow solution
Route of Administration IntramuSubcutaneousular Injection
Recommended Dosage The initial dose is 10,000 U and should be divided between the two to four most affected muscles. Data from clinical studies suggest that efficacy is dose dependent, but these trials, because they were not powered for a comparison, do not show a significant difference between 5000 U and 10,000 U.
Contraindication Hypersensitivity
Side Effects Dry mouth, dysphagia, dyspepsia, and injection site pain.
Useful Link http://www.nhs.uk/medicine-guides/pages/MedicineSideEffects.asp
PubMed ID 10534247, 10534247
3-D Structure Th1037 (View) or (Download)

Entry 5
(5) Primary information
ID 1264
ThPP ID Th1037
Therapeutic Peptide/Protein Name Botulinum Toxin Type B
Sequence MPVTINNFNYNDPIDNNNIIMMEPPFARGTGRYYKAFKITDRIWIIPERY view full sequnce in fasta
Functional Classification Ic
Molecular Weight 150804
Chemical Formula C690H1115N177O202S6
Isoelectric Point N.A.
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life N.A.
Description Neurotoxin produced by fermentation of clostridium botulinum type B. The protein exists in noncovalent association with hemagglutinin and nonhemagglutinin proteins as a neurotoxin complex. The neurotoxin complex is recovered from the fermentation process.
Indication/Disease To treat patients with cervical dystonia to reduce the severity of abnormal head position and neck pain associated with cervical dystonia.
Pharmacodynamics Botulinum Toxin Type B inhibits acetylcholine release at the neuromuscular junction via a three stage process: 1) Heavy Chain mediated neurospecific binding of the toxin, 2) internalization of the toxin by receptor-mediated endocytosis, and 3) ATP and pH dependent translocation of the Light Chain to the neuronal cytosol where it acts as a zinc-dependent endoprotease cleaving polypeptides essential for neurotransmitter release.
Mechanism of Action Botulinum Toxin Type B binds and cleaves the synaptic Vesicle Associated Membrane Protein (VAMP, also known as synaptobrevin) which is a component of the protein complex responsible for docking and fusion of the synaptic vesicle to the presynaptic membrane, a necessary step to neurotransmitter release.
Toxicity One unit of Botulinum Toxin Type B corresponds to the calculated median lethal intraperitoneal dose (LD50) in mice.
Metabolism N.A.
Absorption Botulinum Toxin Type B is not expected to be present in the peripheral blood at measurable levels following IM injection at the recommended doses as pharmacokinetic or ADME studies were not performed
Volume of Distribution N.A.
Clearance N.A.
Categories Antidystonic Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Individuals with known neuromuscular diseases (e.g. amyotrophic lateral sclerosis or peripheral neuropathy) or known neuromuscula r junctional disorders (e.g. myasthenia gravis or Lambert-Eaton syndrome) must not be given NeuroBloc.
Side Effects N.A.
Useful Link http://www.ema.europa.eu/docs/en_GB/document_library/EPAR_-_Product_Information/human/000301/WC500026906.pdf
PubMed ID 10534247, 10534247
3-D Structure Th1037 (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

(1) Primary information
Entry 1
ID	1260
ThPP ID	Th1037
Therapeutic Peptide/Protein Name	Botulinum Toxin Type B
Sequence	MPVTINNFNYNDPIDNNNIIMMEPPFARGTGRYYKAFKITDRIWIIPERY view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	150804
Chemical Formula	C690H1115N177O202S6
Isoelectric Point	N.A.
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	N.A.
Description	Neurotoxin produced by fermentation of clostridium botulinum type B. The protein exists in noncovalent association with hemagglutinin and nonhemagglutinin proteins as a neurotoxin complex. The neurotoxin complex is recovered from the fermentation process.
Indication/Disease	To treat patients with cervical dystonia to reduce the severity of abnormal head position and neck pain associated with cervical dystonia.
Pharmacodynamics	Botulinum Toxin Type B inhibits acetylcholine release at the neuromuscular junction via a three stage process: 1) Heavy Chain mediated neurospecific binding of the toxin, 2) internalization of the toxin by receptor-mediated endocytosis, and 3) ATP and pH dependent translocation of the Light Chain to the neuronal cytosol where it acts as a zinc-dependent endoprotease cleaving polypeptides essential for neurotransmitter release.
Mechanism of Action	Botulinum Toxin Type B binds and cleaves the synaptic Vesicle Associated Membrane Protein (VAMP, also known as synaptobrevin) which is a component of the protein complex responsible for docking and fusion of the synaptic vesicle to the presynaptic membrane, a necessary step to neurotransmitter release.
Toxicity	One unit of Botulinum Toxin Type B corresponds to the calculated median lethal intraperitoneal dose (LD50) in mice.
Metabolism	N.A.
Absorption	Botulinum Toxin Type B is not expected to be present in the peripheral blood at measurable levels following IM injection at the recommended doses as pharmacokinetic or ADME studies were not performed
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Antidystonic Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	Vesicle-associated membrane protein 2,Vesicle-associated membrane protein 1,Synaptotagmin-2
Information of corresponding available drug in the market
Brand Name	Myobloc
Company	Solstice Neurosciences
Brand Discription	MYOBLOC injection is a sterile liquid formulation of a purified neurotoxin that acts at the neuromuscular junction to produce flaccid paralysis. The neurotoxin is produced by fermentation of the bacterium Clostridium botulinum type B (Bean strain) and exi
Prescribed for	It is used for reducing the severity of abnormal head position and neck pain associated with a certain neck problem (cervical dystonia)
Chemical Name	N.A.
Formulation	It is supplied in 3.5-mL glass vials. Each single-use vial of formulated MYOBLOC contains 5,000 Units of botulinum toxin type B per milliliter in 0.05% human serum albumin, 0.01 M sodium succinate, and 0.1 M sodium chloride at approximately pH 5.6.
Physcial Appearance	Clear and colorless to light-yellow Sterile injectable solution
Route of Administration	Injection
Recommended Dosage	The recommended initial dose of MYOBLOC (botulinum toxin type b) for patients with a prior history of tolerating botulinum toxin injections is 2,500 to 5,000 Units divided among affected muscles. Patients without a prior history of tolerating botulinum toxin injections should receive lower initial dose.
Contraindication	MYOBLOC is contraindicated in patients with a known hypersensitivity to any botulinum toxin preparation or to any of the components in the formulation and in patients with infection at the proposed injection site
Side Effects	Anxiety; back pain; dizziness; drowsiness; dry eyes; dry mouth; flu-like symptoms; headache; increased cough; indigestion; nausea; neck pain; pain, redness, swelling, or tenderness at the injection site; runny nose; sensitivity to light; sweating; upset stomach.
Useful Link	http://www.rxlist.com/myobloc-drug.html
PubMed ID	10534247, 10534247
3-D Structure	Th1037 (View) or (Download)

(2) Primary information
Entry 2
ID	1261
ThPP ID	Th1037
Therapeutic Peptide/Protein Name	Botulinum Toxin Type B
Sequence	MPVTINNFNYNDPIDNNNIIMMEPPFARGTGRYYKAFKITDRIWIIPERY view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	150804
Chemical Formula	C690H1115N177O202S6
Isoelectric Point	N.A.
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	N.A.
Description	Neurotoxin produced by fermentation of clostridium botulinum type B. The protein exists in noncovalent association with hemagglutinin and nonhemagglutinin proteins as a neurotoxin complex. The neurotoxin complex is recovered from the fermentation process.
Indication/Disease	To treat patients with cervical dystonia to reduce the severity of abnormal head position and neck pain associated with cervical dystonia.
Pharmacodynamics	Botulinum Toxin Type B inhibits acetylcholine release at the neuromuscular junction via a three stage process: 1) Heavy Chain mediated neurospecific binding of the toxin, 2) internalization of the toxin by receptor-mediated endocytosis, and 3) ATP and pH dependent translocation of the Light Chain to the neuronal cytosol where it acts as a zinc-dependent endoprotease cleaving polypeptides essential for neurotransmitter release.
Mechanism of Action	Botulinum Toxin Type B binds and cleaves the synaptic Vesicle Associated Membrane Protein (VAMP, also known as synaptobrevin) which is a component of the protein complex responsible for docking and fusion of the synaptic vesicle to the presynaptic membrane, a necessary step to neurotransmitter release.
Toxicity	One unit of Botulinum Toxin Type B corresponds to the calculated median lethal intraperitoneal dose (LD50) in mice.
Metabolism	N.A.
Absorption	Botulinum Toxin Type B is not expected to be present in the peripheral blood at measurable levels following IM injection at the recommended doses as pharmacokinetic or ADME studies were not performed
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Antidystonic Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Rash; hives; itching; difficulty breathing; tightness in the chest; swelling of the mouth, face, lips, or tongue; bleeding at the injection site; chest pain; difficulty swallowing or breathing; double or blurred vision, or other vision changes; drooping eyelids, hoarseness, change in or loss of voice; loss of bladder control; or trouble speaking, breathing, or swallowing.
Useful Link	http://www.drugs.com/drug-interactions/botulinum-toxin-type-b,myobloc-index.html
PubMed ID	10534247, 10534247
3-D Structure	Th1037 (View) or (Download)

(3) Primary information
Entry 3
ID	1262
ThPP ID	Th1037
Therapeutic Peptide/Protein Name	Botulinum Toxin Type B
Sequence	MPVTINNFNYNDPIDNNNIIMMEPPFARGTGRYYKAFKITDRIWIIPERY view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	150804
Chemical Formula	C690H1115N177O202S6
Isoelectric Point	N.A.
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	N.A.
Description	Neurotoxin produced by fermentation of clostridium botulinum type B. The protein exists in noncovalent association with hemagglutinin and nonhemagglutinin proteins as a neurotoxin complex. The neurotoxin complex is recovered from the fermentation process.
Indication/Disease	To treat patients with cervical dystonia to reduce the severity of abnormal head position and neck pain associated with cervical dystonia.
Pharmacodynamics	Botulinum Toxin Type B inhibits acetylcholine release at the neuromuscular junction via a three stage process: 1) Heavy Chain mediated neurospecific binding of the toxin, 2) internalization of the toxin by receptor-mediated endocytosis, and 3) ATP and pH dependent translocation of the Light Chain to the neuronal cytosol where it acts as a zinc-dependent endoprotease cleaving polypeptides essential for neurotransmitter release.
Mechanism of Action	Botulinum Toxin Type B binds and cleaves the synaptic Vesicle Associated Membrane Protein (VAMP, also known as synaptobrevin) which is a component of the protein complex responsible for docking and fusion of the synaptic vesicle to the presynaptic membrane, a necessary step to neurotransmitter release.
Toxicity	One unit of Botulinum Toxin Type B corresponds to the calculated median lethal intraperitoneal dose (LD50) in mice.
Metabolism	N.A.
Absorption	Botulinum Toxin Type B is not expected to be present in the peripheral blood at measurable levels following IM injection at the recommended doses as pharmacokinetic or ADME studies were not performed
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Antidystonic Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Seizures; severe or persistent muscle weakness or dizziness; shortness or breath; speech changes or problems; swelling of the hands or feet; vaginal irritation, odor, or discharge; wheezing.
Useful Link	http://www.drugs.com/cdi/myobloc.html
PubMed ID	10534247, 10534247
3-D Structure	Th1037 (View) or (Download)

(4) Primary information
Entry 4
ID	1263
ThPP ID	Th1037
Therapeutic Peptide/Protein Name	Botulinum Toxin Type B
Sequence	MPVTINNFNYNDPIDNNNIIMMEPPFARGTGRYYKAFKITDRIWIIPERY view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	150804
Chemical Formula	C690H1115N177O202S6
Isoelectric Point	N.A.
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	N.A.
Description	Neurotoxin produced by fermentation of clostridium botulinum type B. The protein exists in noncovalent association with hemagglutinin and nonhemagglutinin proteins as a neurotoxin complex. The neurotoxin complex is recovered from the fermentation process.
Indication/Disease	To treat patients with cervical dystonia to reduce the severity of abnormal head position and neck pain associated with cervical dystonia.
Pharmacodynamics	Botulinum Toxin Type B inhibits acetylcholine release at the neuromuscular junction via a three stage process: 1) Heavy Chain mediated neurospecific binding of the toxin, 2) internalization of the toxin by receptor-mediated endocytosis, and 3) ATP and pH dependent translocation of the Light Chain to the neuronal cytosol where it acts as a zinc-dependent endoprotease cleaving polypeptides essential for neurotransmitter release.
Mechanism of Action	Botulinum Toxin Type B binds and cleaves the synaptic Vesicle Associated Membrane Protein (VAMP, also known as synaptobrevin) which is a component of the protein complex responsible for docking and fusion of the synaptic vesicle to the presynaptic membrane, a necessary step to neurotransmitter release.
Toxicity	One unit of Botulinum Toxin Type B corresponds to the calculated median lethal intraperitoneal dose (LD50) in mice.
Metabolism	N.A.
Absorption	Botulinum Toxin Type B is not expected to be present in the peripheral blood at measurable levels following IM injection at the recommended doses as pharmacokinetic or ADME studies were not performed
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Antidystonic Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	The effect of administering different botulinum neurotoxin serotypes concurrently is unknown. However, in clinical studies, NeuroBloc was administered 16 weeks after the injection of Botulinum Toxin Type A. Co-administration of NeuroBloc and aminoglycos
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Neurobloc
Company	Solstice Neurosciences
Brand Discription	Neurobloc is a medicine which is used in muscle spasm of the neck. Neurobloc contains botulinum toxin type b.
Prescribed for	NeuroBloc is indicated for the treatment of cervical dystonia (torticollis) in adults. It means Neurobloc is used to treat muscle spasms of the neck
Chemical Name	N.A.
Formulation	Medicines contain active ingredients and may also contain other, additional ingredients that help ensure the stability, safety and effectiveness of the medicine. Some may be used to prolong the life of the medicine. Neurobloc contains botulinum toxin type
Physcial Appearance	Clear and colourless to light yellow solution
Route of Administration	IntramuSubcutaneousular Injection
Recommended Dosage	The initial dose is 10,000 U and should be divided between the two to four most affected muscles. Data from clinical studies suggest that efficacy is dose dependent, but these trials, because they were not powered for a comparison, do not show a significant difference between 5000 U and 10,000 U.
Contraindication	Hypersensitivity
Side Effects	Dry mouth, dysphagia, dyspepsia, and injection site pain.
Useful Link	http://www.nhs.uk/medicine-guides/pages/MedicineSideEffects.asp
PubMed ID	10534247, 10534247
3-D Structure	Th1037 (View) or (Download)

(5) Primary information
Entry 5
ID	1264
ThPP ID	Th1037
Therapeutic Peptide/Protein Name	Botulinum Toxin Type B
Sequence	MPVTINNFNYNDPIDNNNIIMMEPPFARGTGRYYKAFKITDRIWIIPERY view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	150804
Chemical Formula	C690H1115N177O202S6
Isoelectric Point	N.A.
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	N.A.
Description	Neurotoxin produced by fermentation of clostridium botulinum type B. The protein exists in noncovalent association with hemagglutinin and nonhemagglutinin proteins as a neurotoxin complex. The neurotoxin complex is recovered from the fermentation process.
Indication/Disease	To treat patients with cervical dystonia to reduce the severity of abnormal head position and neck pain associated with cervical dystonia.
Pharmacodynamics	Botulinum Toxin Type B inhibits acetylcholine release at the neuromuscular junction via a three stage process: 1) Heavy Chain mediated neurospecific binding of the toxin, 2) internalization of the toxin by receptor-mediated endocytosis, and 3) ATP and pH dependent translocation of the Light Chain to the neuronal cytosol where it acts as a zinc-dependent endoprotease cleaving polypeptides essential for neurotransmitter release.
Mechanism of Action	Botulinum Toxin Type B binds and cleaves the synaptic Vesicle Associated Membrane Protein (VAMP, also known as synaptobrevin) which is a component of the protein complex responsible for docking and fusion of the synaptic vesicle to the presynaptic membrane, a necessary step to neurotransmitter release.
Toxicity	One unit of Botulinum Toxin Type B corresponds to the calculated median lethal intraperitoneal dose (LD50) in mice.
Metabolism	N.A.
Absorption	Botulinum Toxin Type B is not expected to be present in the peripheral blood at measurable levels following IM injection at the recommended doses as pharmacokinetic or ADME studies were not performed
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Antidystonic Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Individuals with known neuromuscular diseases (e.g. amyotrophic lateral sclerosis or peripheral neuropathy) or known neuromuscula r junctional disorders (e.g. myasthenia gravis or Lambert-Eaton syndrome) must not be given NeuroBloc.
Side Effects	N.A.
Useful Link	http://www.ema.europa.eu/docs/en_GB/document_library/EPAR_-_Product_Information/human/000301/WC500026906.pdf
PubMed ID	10534247, 10534247
3-D Structure	Th1037 (View) or (Download)