| Entry 1 |
| (1) Primary information |
|---|
| ID | 1260 |
| ThPP ID | Th1037 |
| Therapeutic Peptide/Protein Name | Botulinum Toxin Type B |
| Sequence | MPVTINNFNYNDPIDNNNIIMMEPPFARGTGRYYKAFKITDRIWIIPERY view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 150804 |
| Chemical Formula | C690H1115N177O202S6 |
| Isoelectric Point | N.A. |
| Hydrophobicity | N.A. |
| Melting Point (℃) | N.A. |
| Half Life | N.A. |
| Description | Neurotoxin produced by fermentation of clostridium botulinum type B. The protein exists in noncovalent association with hemagglutinin and nonhemagglutinin proteins as a neurotoxin complex. The neurotoxin complex is recovered from the fermentation process. |
| Indication/Disease | To treat patients with cervical dystonia to reduce the severity of abnormal head position and neck pain associated with cervical dystonia. |
| Pharmacodynamics | Botulinum Toxin Type B inhibits acetylcholine release at the neuromuscular junction via a three stage process: 1) Heavy Chain mediated neurospecific binding of the toxin, 2) internalization of the toxin by receptor-mediated endocytosis, and 3) ATP and pH dependent translocation of the Light Chain to the neuronal cytosol where it acts as a zinc-dependent endoprotease cleaving polypeptides essential for neurotransmitter release. |
| Mechanism of Action | Botulinum Toxin Type B binds and cleaves the synaptic Vesicle Associated Membrane Protein (VAMP, also known as synaptobrevin) which is a component of the protein complex responsible for docking and fusion of the synaptic vesicle to the presynaptic membrane, a necessary step to neurotransmitter release. |
| Toxicity | One unit of Botulinum Toxin Type B corresponds to the calculated median lethal intraperitoneal dose (LD50) in mice. |
| Metabolism | N.A. |
| Absorption | Botulinum Toxin Type B is not expected to be present in the peripheral blood at measurable levels following IM injection at the recommended doses as pharmacokinetic or ADME studies were not performed |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Antidystonic Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | Vesicle-associated membrane protein 2,Vesicle-associated membrane protein 1,Synaptotagmin-2 |
| Information of corresponding available drug in the market |
|---|
| Brand Name | Myobloc |
| Company | Solstice Neurosciences |
| Brand Discription | MYOBLOC injection is a sterile liquid formulation of a purified neurotoxin that acts at the neuromuscular junction to produce flaccid paralysis. The neurotoxin is produced by fermentation of the bacterium Clostridium botulinum type B (Bean strain) and exi |
| Prescribed for | It is used for reducing the severity of abnormal head position and neck pain associated with a certain neck problem (cervical dystonia) |
| Chemical Name | N.A. |
| Formulation | It is supplied in 3.5-mL glass vials. Each single-use vial of formulated MYOBLOC contains 5,000 Units of botulinum toxin type B per milliliter in 0.05% human serum albumin, 0.01 M sodium succinate, and 0.1 M sodium chloride at approximately pH 5.6. |
| Physcial Appearance | Clear and colorless to light-yellow Sterile injectable solution |
| Route of Administration | Injection |
| Recommended Dosage | The recommended initial dose of MYOBLOC (botulinum toxin type b) for patients with a prior history of tolerating botulinum toxin injections is 2,500 to 5,000 Units divided among affected muscles. Patients without a prior history of tolerating botulinum toxin injections should receive lower initial dose. |
| Contraindication | MYOBLOC is contraindicated in patients with a known hypersensitivity to any botulinum toxin preparation or to any of the components in the formulation and in patients with infection at the proposed injection site |
| Side Effects | Anxiety; back pain; dizziness; drowsiness; dry eyes; dry mouth; flu-like symptoms; headache; increased cough; indigestion; nausea; neck pain; pain, redness, swelling, or tenderness at the injection site; runny nose; sensitivity to light; sweating; upset stomach. |
| Useful Link | http://www.rxlist.com/myobloc-drug.html |
| PubMed ID | 10534247, 10534247 |
| 3-D Structure | Th1037 (View) or (Download) |
| Entry 2 |
| (2) Primary information |
|---|
| ID | 1261 |
| ThPP ID | Th1037 |
| Therapeutic Peptide/Protein Name | Botulinum Toxin Type B |
| Sequence | MPVTINNFNYNDPIDNNNIIMMEPPFARGTGRYYKAFKITDRIWIIPERY view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 150804 |
| Chemical Formula | C690H1115N177O202S6 |
| Isoelectric Point | N.A. |
| Hydrophobicity | N.A. |
| Melting Point (℃) | N.A. |
| Half Life | N.A. |
| Description | Neurotoxin produced by fermentation of clostridium botulinum type B. The protein exists in noncovalent association with hemagglutinin and nonhemagglutinin proteins as a neurotoxin complex. The neurotoxin complex is recovered from the fermentation process. |
| Indication/Disease | To treat patients with cervical dystonia to reduce the severity of abnormal head position and neck pain associated with cervical dystonia. |
| Pharmacodynamics | Botulinum Toxin Type B inhibits acetylcholine release at the neuromuscular junction via a three stage process: 1) Heavy Chain mediated neurospecific binding of the toxin, 2) internalization of the toxin by receptor-mediated endocytosis, and 3) ATP and pH dependent translocation of the Light Chain to the neuronal cytosol where it acts as a zinc-dependent endoprotease cleaving polypeptides essential for neurotransmitter release. |
| Mechanism of Action | Botulinum Toxin Type B binds and cleaves the synaptic Vesicle Associated Membrane Protein (VAMP, also known as synaptobrevin) which is a component of the protein complex responsible for docking and fusion of the synaptic vesicle to the presynaptic membrane, a necessary step to neurotransmitter release. |
| Toxicity | One unit of Botulinum Toxin Type B corresponds to the calculated median lethal intraperitoneal dose (LD50) in mice. |
| Metabolism | N.A. |
| Absorption | Botulinum Toxin Type B is not expected to be present in the peripheral blood at measurable levels following IM injection at the recommended doses as pharmacokinetic or ADME studies were not performed |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Antidystonic Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | Rash; hives; itching; difficulty breathing; tightness in the chest; swelling of the mouth, face, lips, or tongue; bleeding at the injection site; chest pain; difficulty swallowing or breathing; double or blurred vision, or other vision changes; drooping eyelids, hoarseness, change in or loss of voice; loss of bladder control; or trouble speaking, breathing, or swallowing. |
| Useful Link | http://www.drugs.com/drug-interactions/botulinum-toxin-type-b,myobloc-index.html |
| PubMed ID | 10534247, 10534247 |
| 3-D Structure | Th1037 (View) or (Download) |
| Entry 3 |
| (3) Primary information |
|---|
| ID | 1262 |
| ThPP ID | Th1037 |
| Therapeutic Peptide/Protein Name | Botulinum Toxin Type B |
| Sequence | MPVTINNFNYNDPIDNNNIIMMEPPFARGTGRYYKAFKITDRIWIIPERY view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 150804 |
| Chemical Formula | C690H1115N177O202S6 |
| Isoelectric Point | N.A. |
| Hydrophobicity | N.A. |
| Melting Point (℃) | N.A. |
| Half Life | N.A. |
| Description | Neurotoxin produced by fermentation of clostridium botulinum type B. The protein exists in noncovalent association with hemagglutinin and nonhemagglutinin proteins as a neurotoxin complex. The neurotoxin complex is recovered from the fermentation process. |
| Indication/Disease | To treat patients with cervical dystonia to reduce the severity of abnormal head position and neck pain associated with cervical dystonia. |
| Pharmacodynamics | Botulinum Toxin Type B inhibits acetylcholine release at the neuromuscular junction via a three stage process: 1) Heavy Chain mediated neurospecific binding of the toxin, 2) internalization of the toxin by receptor-mediated endocytosis, and 3) ATP and pH dependent translocation of the Light Chain to the neuronal cytosol where it acts as a zinc-dependent endoprotease cleaving polypeptides essential for neurotransmitter release. |
| Mechanism of Action | Botulinum Toxin Type B binds and cleaves the synaptic Vesicle Associated Membrane Protein (VAMP, also known as synaptobrevin) which is a component of the protein complex responsible for docking and fusion of the synaptic vesicle to the presynaptic membrane, a necessary step to neurotransmitter release. |
| Toxicity | One unit of Botulinum Toxin Type B corresponds to the calculated median lethal intraperitoneal dose (LD50) in mice. |
| Metabolism | N.A. |
| Absorption | Botulinum Toxin Type B is not expected to be present in the peripheral blood at measurable levels following IM injection at the recommended doses as pharmacokinetic or ADME studies were not performed |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Antidystonic Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | Seizures; severe or persistent muscle weakness or dizziness; shortness or breath; speech changes or problems; swelling of the hands or feet; vaginal irritation, odor, or discharge; wheezing. |
| Useful Link | http://www.drugs.com/cdi/myobloc.html |
| PubMed ID | 10534247, 10534247 |
| 3-D Structure | Th1037 (View) or (Download) |
| Entry 4 |
| (4) Primary information |
|---|
| ID | 1263 |
| ThPP ID | Th1037 |
| Therapeutic Peptide/Protein Name | Botulinum Toxin Type B |
| Sequence | MPVTINNFNYNDPIDNNNIIMMEPPFARGTGRYYKAFKITDRIWIIPERY view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 150804 |
| Chemical Formula | C690H1115N177O202S6 |
| Isoelectric Point | N.A. |
| Hydrophobicity | N.A. |
| Melting Point (℃) | N.A. |
| Half Life | N.A. |
| Description | Neurotoxin produced by fermentation of clostridium botulinum type B. The protein exists in noncovalent association with hemagglutinin and nonhemagglutinin proteins as a neurotoxin complex. The neurotoxin complex is recovered from the fermentation process. |
| Indication/Disease | To treat patients with cervical dystonia to reduce the severity of abnormal head position and neck pain associated with cervical dystonia. |
| Pharmacodynamics | Botulinum Toxin Type B inhibits acetylcholine release at the neuromuscular junction via a three stage process: 1) Heavy Chain mediated neurospecific binding of the toxin, 2) internalization of the toxin by receptor-mediated endocytosis, and 3) ATP and pH dependent translocation of the Light Chain to the neuronal cytosol where it acts as a zinc-dependent endoprotease cleaving polypeptides essential for neurotransmitter release. |
| Mechanism of Action | Botulinum Toxin Type B binds and cleaves the synaptic Vesicle Associated Membrane Protein (VAMP, also known as synaptobrevin) which is a component of the protein complex responsible for docking and fusion of the synaptic vesicle to the presynaptic membrane, a necessary step to neurotransmitter release. |
| Toxicity | One unit of Botulinum Toxin Type B corresponds to the calculated median lethal intraperitoneal dose (LD50) in mice. |
| Metabolism | N.A. |
| Absorption | Botulinum Toxin Type B is not expected to be present in the peripheral blood at measurable levels following IM injection at the recommended doses as pharmacokinetic or ADME studies were not performed |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Antidystonic Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | The effect of administering different botulinum neurotoxin serotypes concurrently is unknown. However, in clinical studies, NeuroBloc was administered 16 weeks after the injection of Botulinum Toxin Type A. Co-administration of NeuroBloc and aminoglycos |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | Neurobloc |
| Company | Solstice Neurosciences |
| Brand Discription | Neurobloc is a medicine which is used in muscle spasm of the neck. Neurobloc contains botulinum toxin type b. |
| Prescribed for | NeuroBloc is indicated for the treatment of cervical dystonia (torticollis) in adults. It means Neurobloc is used to treat muscle spasms of the neck |
| Chemical Name | N.A. |
| Formulation | Medicines contain active ingredients and may also contain other, additional ingredients that help ensure the stability, safety and effectiveness of the medicine. Some may be used to prolong the life of the medicine. Neurobloc contains botulinum toxin type |
| Physcial Appearance | Clear and colourless to light yellow solution |
| Route of Administration | IntramuSubcutaneousular Injection |
| Recommended Dosage | The initial dose is 10,000 U and should be divided between the two to four most affected muscles. Data from clinical studies suggest that efficacy is dose dependent, but these trials, because they were not powered for a comparison, do not show a significant difference between 5000 U and 10,000 U. |
| Contraindication | Hypersensitivity |
| Side Effects | Dry mouth, dysphagia, dyspepsia, and injection site pain. |
| Useful Link | http://www.nhs.uk/medicine-guides/pages/MedicineSideEffects.asp |
| PubMed ID | 10534247, 10534247 |
| 3-D Structure | Th1037 (View) or (Download) |
| Entry 5 |
| (5) Primary information |
|---|
| ID | 1264 |
| ThPP ID | Th1037 |
| Therapeutic Peptide/Protein Name | Botulinum Toxin Type B |
| Sequence | MPVTINNFNYNDPIDNNNIIMMEPPFARGTGRYYKAFKITDRIWIIPERY view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 150804 |
| Chemical Formula | C690H1115N177O202S6 |
| Isoelectric Point | N.A. |
| Hydrophobicity | N.A. |
| Melting Point (℃) | N.A. |
| Half Life | N.A. |
| Description | Neurotoxin produced by fermentation of clostridium botulinum type B. The protein exists in noncovalent association with hemagglutinin and nonhemagglutinin proteins as a neurotoxin complex. The neurotoxin complex is recovered from the fermentation process. |
| Indication/Disease | To treat patients with cervical dystonia to reduce the severity of abnormal head position and neck pain associated with cervical dystonia. |
| Pharmacodynamics | Botulinum Toxin Type B inhibits acetylcholine release at the neuromuscular junction via a three stage process: 1) Heavy Chain mediated neurospecific binding of the toxin, 2) internalization of the toxin by receptor-mediated endocytosis, and 3) ATP and pH dependent translocation of the Light Chain to the neuronal cytosol where it acts as a zinc-dependent endoprotease cleaving polypeptides essential for neurotransmitter release. |
| Mechanism of Action | Botulinum Toxin Type B binds and cleaves the synaptic Vesicle Associated Membrane Protein (VAMP, also known as synaptobrevin) which is a component of the protein complex responsible for docking and fusion of the synaptic vesicle to the presynaptic membrane, a necessary step to neurotransmitter release. |
| Toxicity | One unit of Botulinum Toxin Type B corresponds to the calculated median lethal intraperitoneal dose (LD50) in mice. |
| Metabolism | N.A. |
| Absorption | Botulinum Toxin Type B is not expected to be present in the peripheral blood at measurable levels following IM injection at the recommended doses as pharmacokinetic or ADME studies were not performed |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Antidystonic Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | Individuals with known neuromuscular diseases (e.g. amyotrophic lateral sclerosis or peripheral neuropathy) or known neuromuscula r junctional disorders (e.g. myasthenia gravis or Lambert-Eaton syndrome) must not be given NeuroBloc. |
| Side Effects | N.A. |
| Useful Link | http://www.ema.europa.eu/docs/en_GB/document_library/EPAR_-_Product_Information/human/000301/WC500026906.pdf |
| PubMed ID | 10534247, 10534247 |
| 3-D Structure | Th1037 (View) or (Download) |